KEGG   Marinobacter sp. LQ44: ASQ50_03700Help
Entry
ASQ50_03700       CDS       T04470                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mlq  Marinobacter sp. LQ44
Pathway
mlq00071  Fatty acid degradation
mlq00072  Synthesis and degradation of ketone bodies
mlq00280  Valine, leucine and isoleucine degradation
mlq00310  Lysine degradation
mlq00362  Benzoate degradation
mlq00380  Tryptophan metabolism
mlq00620  Pyruvate metabolism
mlq00630  Glyoxylate and dicarboxylate metabolism
mlq00640  Propanoate metabolism
mlq00650  Butanoate metabolism
mlq00900  Terpenoid backbone biosynthesis
mlq01100  Metabolic pathways
mlq01110  Biosynthesis of secondary metabolites
mlq01120  Microbial metabolism in diverse environments
mlq01130  Biosynthesis of antibiotics
mlq01200  Carbon metabolism
mlq01212  Fatty acid metabolism
mlq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ASQ50_03700
   00630 Glyoxylate and dicarboxylate metabolism
    ASQ50_03700
   00640 Propanoate metabolism
    ASQ50_03700
   00650 Butanoate metabolism
    ASQ50_03700
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ASQ50_03700
   00072 Synthesis and degradation of ketone bodies
    ASQ50_03700
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ASQ50_03700
   00310 Lysine degradation
    ASQ50_03700
   00380 Tryptophan metabolism
    ASQ50_03700
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ASQ50_03700
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ASQ50_03700
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ASQ50_03700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mlq04147]
    ASQ50_03700
Enzymes [BR:mlq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ASQ50_03700
Exosome [BR:mlq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ASQ50_03700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Dodecin
Motif
Other DBs
NCBI-ProteinID: AMQ87851
UniProt: A0A142FMZ2
Position
781663..782871
Genome map
AA seq 402 aa AA seqDB search
MTTEAYIFDAVRTPRGRGKKDGSLHSVKPISLLTTVLKALQERNQLDTAQVDDIVMGCVT
AVGDQGADIAKTAALAADWDEKVAGVTLNRFCASGLEAVNLAAMKVRSGWEDMVVAGGVE
AMSRVPMGSDGGAWATDPETNLHTGFMPQGIGADLIATLEGFSREDVDGFAVKSQQKAAS
AWDKGYFAKSIVPVTDQNGVVILDRDEHVRGNTTVESLAGLKPSFQMMGEMGFDGVAREK
YHYVEKINHVHHAGNSSGIVDGATAMLIGSEAKGKELGLKPRARIVATAVTSTDPTIMLT
GPAPAARKALEKAGMTVDQIDLFEVNEAFASVVMRFQKELSVPDEKVNVNGGAIAMGHPL
GATGAIILGTLLDELERRELRYGLATLCVGGGMGIATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgaggcgtacatcttcgatgccgtccgcacgccacgcggccgcggaaagaaa
gacggatctttgcacagcgtcaaacccatctccctgctgaccaccgtgctcaaggccctg
caggagcgtaaccagctcgataccgcccaggtagacgacatcgtgatgggttgtgtcacc
gccgtgggcgatcagggcgcggatatcgccaaaactgccgcactcgcagccgactgggac
gaaaaagtggccggcgtcaccttgaaccgtttctgcgcctccggcctggaagccgttaac
ctggctgccatgaaagtgcgttccggctgggaagacatggtggttgccggtggtgtcgag
gcgatgtctcgcgttccgatgggctccgatggcggcgcctgggcaaccgacccggaaacc
aacctgcacaccggtttcatgcctcagggcatcggtgccgatctgatcgccactctggaa
ggcttcagtcgcgaagatgtcgatggctttgctgtgaaatcccagcaaaaagcggccagc
gcctgggataagggctactttgcgaaatccattgtgccggtcaccgaccagaacggcgtg
gtcatcctggaccgggacgagcatgtacgcggtaacaccaccgtagaatcccttgccggc
ctcaagccctcgttccagatgatgggcgaaatgggctttgatggcgtcgcccgagagaag
tatcactacgtagagaagatcaatcacgtgcaccacgccggcaattcctccggcattgtc
gacggcgccaccgccatgctgatcggcagcgaagccaaaggcaaagaactgggcctgaag
ccccgcgcccgcattgtcgccactgcggttaccagcaccgaccccaccatcatgctcacc
ggcccggcccctgctgcccgtaaggcgctggagaaagccggcatgaccgtggaccagatc
gacctgtttgaagtgaacgaagccttcgcctcggtggtgatgcgtttccagaaagaactg
tccgttccggacgagaaagtgaacgtcaatggcggcgccatcgccatgggccacccgttg
ggtgctaccggcgccatcatcctcggcaccctgctggatgaactggaacgccgtgaactg
cgctacggcctggccaccctgtgtgtgggcggcggcatgggcattgccaccatcatcgag
cgcgtctga

DBGET integrated database retrieval system