KEGG   Marinobacter sp. LQ44: ASQ50_07850Help
Entry
ASQ50_07850       CDS       T04470                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mlq  Marinobacter sp. LQ44
Pathway
mlq00020  Citrate cycle (TCA cycle)
mlq00620  Pyruvate metabolism
mlq01100  Metabolic pathways
mlq01110  Biosynthesis of secondary metabolites
mlq01120  Microbial metabolism in diverse environments
mlq01130  Biosynthesis of antibiotics
mlq01200  Carbon metabolism
Module
mlq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mlq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASQ50_07850
   00620 Pyruvate metabolism
    ASQ50_07850
Enzymes [BR:mlq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     ASQ50_07850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 P_proprotein
Motif
Other DBs
NCBI-ProteinID: AMQ88615
UniProt: A0A142FQ56
Position
complement(1672143..1673624)
Genome map
AA seq 493 aa AA seqDB search
MAVRQADVVLVGGGVMSATLGMMLRQLDPSLDIVMVERLDHVAHESTDGWNNAGTGHAGY
CELNYTPETDDGDVEIARALQINAQFEVSLQFWSYLVEQGILPEPSTFINRTPHQSFVWG
EKDVAFLKRRFERLKAHHLFREMEYTESPNDLAEWMPLVVKHRDPMQRVAATRIKHGSDV
DFGSLTRSMVAWLETQPNFELMLSSPVHYIDQRDNGRWKLRVKNQKTGELTKLEAGFVFL
GAGGGALPLLQKSGIDEARGYGGFPVSGQWLVCQKPDIVQAHNSKVYGKAPIGAPPMSVP
HLDTRIINGEPALLFGPFAGFTTRFLKQGSVFDLFGSVRATNLRPMLSVSKSNMDLTRYL
IGEVFQSHTDRVESLRNFFPDAREEDWRLQMAGQRVQIIKQTPEGGGKLEFGTEIVAAKD
GTLAALLGASPGASTAANAMLNVLERCFPENMKSQQWLERMKELVPSYGQSLVNDEQLLN
RVRERTLSTLKLG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggccgttagacaggcagacgtagtgctggtcggtgggggcgtcatgagcgcaaccctc
ggcatgatgctcaggcagctggacccgtcactggatatcgtcatggtggagcgtttagac
cacgttgcccatgaaagcacagacggatggaataacgcaggtaccggccacgccggctac
tgtgaactcaactacacccccgaaaccgacgatggcgacgttgaaattgccagagctctg
caaatcaatgcgcagtttgaggtgtcgctgcagttctggtcgtacctggtagagcagggc
attctgccagagccttctacgtttattaaccgcacgccacaccagagctttgtctggggt
gagaaagacgtcgctttcctcaagcgccggttcgagcgcctgaaagcccatcacctgttc
cgggagatggaatacaccgagagcccgaacgacctggccgagtggatgccgctggtggtc
aaacatcgcgacccgatgcaacgtgtggctgcaacccgcatcaagcatggctctgatgtg
gatttcggttccctgacccgtagcatggtcgcgtggctggaaacccagcccaactttgag
ttgatgctcagcagcccggtgcattacatcgaccagcgggacaatggccgctggaagctg
cgggtgaagaaccagaaaaccggtgagctgaccaagctggaggccggtttcgtgttcctg
ggggccggtggcggtgccctgccgctgttacaaaaatccggcattgatgaagcgcgcggt
tacggcggcttcccggtgagtggtcagtggctggtgtgccagaagccggatatcgtgcaa
gcgcacaactccaaggtatacggcaaggcgccgatcggtgcaccgcctatgtcggtgcca
catctggacacccgaatcattaacggcgagccggcactgctgttcgggccctttgcaggc
tttaccacccgtttcctgaagcagggctcggtgtttgacctgttcggttctgtgcgcgcc
actaacctgcggccaatgctgtcggtcagcaagagcaacatggatctgacccgttatctg
attggtgaagtgttccagtctcacaccgaccgggtagagtcgctgcgtaacttcttcccg
gatgcccgcgaagaagactggcggctgcagatggcgggccagcgggtgcaaatcatcaag
caaaccccggaaggcggaggcaagcttgagttcggtactgagattgtggctgccaaagat
ggcacgctggcggcactgctgggtgcttcccctggtgcatcaacagcggccaacgccatg
ctgaatgtacttgagcggtgtttcccggagaacatgaagtcgcagcagtggctggaacga
atgaaggaactggtcccctcctacggacaatctctggtgaacgacgagcaactgctcaat
cgggtacgggagcgaaccctgtctaccctgaaactgggctga

DBGET integrated database retrieval system