KEGG   Marinobacter sp. LQ44: ASQ50_09740Help
Entry
ASQ50_09740       CDS       T04470                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mlq  Marinobacter sp. LQ44
Pathway
mlq00860  Porphyrin and chlorophyll metabolism
mlq01100  Metabolic pathways
Module
mlq_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ASQ50_09740
Enzymes [BR:mlq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     ASQ50_09740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB GATase VirC1 BPL_N
Motif
Other DBs
NCBI-ProteinID: AMQ88952
UniProt: A0A142FR43
Position
complement(2091910..2093379)
Genome map
AA seq 489 aa AA seqDB search
MPTLMVQGTTSDAGKTTVVAALCRWLARQGVSVAPFKPQNMALNSAVTVDGGEIGRSTAL
QALACGLEPHSDMNPVLLKPQSDCGAQVILRGKVHGNMDALDYHAYKAEAMASVLASWQA
LDERYDVIIAEGAGSPAEINLRANDIANMGFAEAADCPVLLVGDIDKGGVFAQLVGTLAL
ISDSEQARTAGFIINRFRGDIALLEPGLDWLAEHTGKPVFGVLPYLHGLVIDSEDSVSAA
GTSEAGALKVVVPVLPRISNHNDFDPLRLHPGVDLVFVGPDESIPPADLIILPGSKSTRH
DLQWLKQQGWPEAIQKHLRYGGKLLGICGGFQMLGLRVEDPDGLEGEVGNTEGLALFEMV
TRMVSGKQLRQVTGRLSTEVAGSGVKATMTGYEMHNGVTEGSALARPFAVIDGRPDGAVS
ADGQLVGTYVHGLFDEPAACDAILCWAGLNTQSAQSVDYQSHRLQQLDRLADQVEQYLDT
DRLRSLLQL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcccactctgatggtgcagggcaccacctcggatgccggcaagaccacggtggtggcg
gccctgtgccgctggctggcgcgtcagggcgtgtcggtggcgccgtttaaaccccagaac
atggccctgaacagtgcggtcaccgtggatggtggggaaatcggccgctccacggcattg
caggcgctggcctgtggtctggagccccacagtgacatgaacccggtgttgctgaagccc
cagagcgattgcggagcccaggtcatcctgcgggggaaggttcacggcaatatggatgcc
ctggactaccatgcctacaaggccgaggccatggcctccgtgctggccagttggcaggcc
ctggacgagcgttatgatgtgatcattgccgagggtgccggtagcccggcggaaatcaac
ctgcgggccaacgacattgccaacatgggcttcgccgaggccgccgattgcccggtgctg
ttagtaggtgatatcgataaaggcggtgtgtttgcccagttggtgggcaccctggcgttg
atctccgacagtgaacaagccagaacggccggatttatcatcaatcggttccggggtgac
attgcgctgttggagcccgggctggactggctggccgaacacactggcaagccggtgttc
ggggtcttgccctacctgcacgggttggtgatagattccgaagacagtgtcagtgccgcc
ggtaccagtgaggccggcgccttgaaagtggtggtgccggtactgcccaggatcagcaac
cacaatgattttgatccgttgcgattgcacccgggggtggacctggttttcgtggggccg
gatgagtccattccgccggcagacctgattattctgcccggcagcaaaagtacccgccac
gacctgcagtggctgaaacaacagggctggcccgaggccatccagaaacacctgcgctat
ggcggcaagctgctgggtatctgtggcggattccagatgctggggcttcgggtggaagac
ccggacgggctggaaggcgaagttggcaataccgagggcctggcactgttcgagatggtc
acccgcatggtgtcgggtaagcagctcagacaggtgaccggcaggctatccaccgaggtt
gctggaagtggtgttaaggcgacaatgaccggctatgaaatgcacaacggagtcaccgaa
ggctcagcgctggccaggccttttgcggtgattgatgggcgaccggacggtgcggtcagc
gccgacggtcagttggtgggcacctatgtgcacggtctctttgatgagcctgcggcctgc
gatgccattctgtgctgggctggtctcaatacacagagtgcgcaatcagtggattatcag
agtcaccgtctgcagcaactcgaccgcctggcagatcaggtggaacagtatctggacacg
gaccggttaaggagcctgttgcagttatga

DBGET integrated database retrieval system