KEGG   Marinobacter sp. LQ44: ASQ50_19720Help
Entry
ASQ50_19720       CDS       T04470                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mlq  Marinobacter sp. LQ44
Pathway
mlq00030  Pentose phosphate pathway
mlq00480  Glutathione metabolism
mlq01100  Metabolic pathways
mlq01110  Biosynthesis of secondary metabolites
mlq01120  Microbial metabolism in diverse environments
mlq01130  Biosynthesis of antibiotics
mlq01200  Carbon metabolism
Module
mlq_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ASQ50_19720
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ASQ50_19720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mlq04147]
    ASQ50_19720
Enzymes [BR:mlq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     ASQ50_19720
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     ASQ50_19720
Exosome [BR:mlq04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ASQ50_19720
  Exosomal proteins of colorectal cancer cells
   ASQ50_19720
  Exosomal proteins of bladder cancer cells
   ASQ50_19720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AMQ90735
UniProt: A0A142FW76
Position
4312620..4314095
Genome map
AA seq 491 aa AA seqDB search
MVNRTATRCDLMLFGALGDLAQRKLFPALYQLERAGLLAPGSRILAVARTEAGTDKVKEQ
LLEKLKKHVKSEEFDPDIAQSFLQRVEYQRLDFNDPEGYQALRDWRDEPDNQLIVYMATP
PSMYGVIARNLEATRCCNERTRVVVEKPIGHDLETSRVINDELGQVYNENQIFRIDHYLG
KETVQNLIALRFANNLFASQWDQNHISHVEITVAESVGIEGRWGYFDKAGQIRDMIQNHL
LQLLCLIAMDPPADLSADSIRDEKVKVLKALKQITPELMGSHVVRGQYTAGTSGGQPVPG
YLEEEGANKGSETETFVALKAEIDNWRWSGVPFYIRTGKRLPEKLSQIIIHFKPAPHYIF
DPDQKHLANNKLIIRLQPDEGMSLKILTKDQGLDKGMRLRQGPLELTFSETFETDRIPDA
YERLLWEVMKGNQYLFVRRDEVEYAWRWVDQVIANWHDSGEPPKRYAAGTWGPVASIAMI
TRDGRSWYEDA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaccgtaccgctacccgttgtgacctaatgctattcggggcgctgggggatctt
gcccagcgcaaactcttcccggccctgtatcaacttgaacgggcgggcctgctggcgcct
ggcagtcgcatacttgccgttgcgcgaaccgaggccggcacggacaaggtgaaagaacag
ctgttggagaaactgaaaaaacacgtgaagtccgaagagtttgacccggatatcgcgcag
tcttttctccagcgagtggaatatcagcgtctcgacttcaatgacccggagggctaccag
gcgcttcgggactggcgggacgagccggataaccagttgattgtctacatggcaactccg
ccatcaatgtacggggtgattgcccgcaacctcgaggcaacccgttgctgcaatgagcgg
acgagggttgtggttgaaaaacccattgggcacgacctggaaacctccagggtgatcaat
gatgagttggggcaggtatacaacgagaatcagatcttccggattgatcactatctgggc
aaggaaaccgtgcagaacctgattgccctgcgctttgccaacaacctctttgcttcccag
tgggatcaaaatcacatctcccacgtggaaattacggttgcggaaagcgtgggtatcgaa
gggcgctgggggtattttgacaaggccggtcagatacgggacatgatccagaatcacctg
ctgcagttgctttgcctgattgcgatggatccgccggcggatctgtccgcggacagcatt
cgcgacgagaaagtgaaggtgctcaaggcgctcaagcagattacccctgaattgatgggc
agccatgtggttcgtggccagtacaccgcaggcaccagtggcggccagccggtaccgggg
tacctggaagaagaaggggcgaacaagggcagcgagacggaaacctttgtggccttgaag
gcggagatcgacaactggcgctggtctggcgtgccgttctatatccgtaccggcaagcgg
cttccggaaaagttgtcccagattattattcatttcaagccggcgccccattacatcttt
gatccagaccagaagcatctggccaataacaaactcattatccgcctgcagcccgatgag
ggcatgtccctgaagattctcaccaaggaccagggactggataaaggtatgcgccttcgc
caggggccgttggagctgacgttctcggagacgttcgaaaccgaccggattcctgatgcc
tatgaacgtttactgtgggaagtgatgaaggggaatcagtacctgtttgtgcgtcgtgat
gaggttgagtacgcctggcgctgggtggatcaggttattgcaaactggcatgacagcggc
gaaccacccaaacgctatgccgcaggaacttgggggccggtggcatccatcgccatgatt
acccgggatgggagaagctggtatgaagatgcctga

DBGET integrated database retrieval system