KEGG   Marinobacter sp. LQ44: ASQ50_19930Help
Entry
ASQ50_19930       CDS       T04470                                 

Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
mlq  Marinobacter sp. LQ44
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mlq03009]
    ASQ50_19930
Enzymes [BR:mlq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     ASQ50_19930
Ribosome biogenesis [BR:mlq03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ASQ50_19930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AMQ90772
UniProt: A0A142FWB3
Position
4363810..4364886
Genome map
AA seq 358 aa AA seqDB search
MQQVMLVCRPGFEAEAGQEVTDQAALKGVFGYFQPVRNSGLVRFTIGSEESPEELMGRLP
LDELVFVRDWFVILGDCALPVQDRVGAVVGFLRDQDWKGSGCARVEVRLPENNEDRDLGN
FSRKWVAPLSKGLRGAGLLQETADAKTRKRLEILLADFGMAVIGYSLAGNRSPFPGGVPR
LRLPASAPSRSALKLEEAWKVFLPEDRWLDYLGGGRKAVDLGAAPGGWTWQLVNQGMMVT
AVDNGPMNPDLMASGHVEHIEADGYAWRPKRAVDWMVCDIVDKPRRTARMAVDWLADRLC
RYTVFNLKLPMKKRYDEWLVCQDILVRGLEEAGLTCRVRARHLYHDREEITCFIERLD
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaggttatgctggtgtgccgcccgggattcgaagccgaggcgggccaggaagtg
acggatcaggcagcccttaaaggcgtgtttggttattttcagccggtcaggaacagcggg
ttggtccggtttaccattggcagtgaggaaagcccggaggaactgatgggccgcctgccg
ttggacgaactggtatttgttcgggactggttcgttatcctgggcgattgtgcgttgcca
gtacaggatcgggttggggccgtggtcggttttctgcgagatcaggattggaaggggagt
ggctgtgcccgggtagaggtgcgtttaccggagaacaacgaggaccgggacctgggtaac
ttttcccgaaaatgggtggcgccgttatccaagggcctgcggggcgcgggattgcttcag
gaaacggcggatgcaaagactagaaaacggctggaaatactgctggcagactttggtatg
gctgtgattgggtacagcctcgctggtaaccggtcgccgttccctgggggcgtgccgcgg
ctcagattacccgcctcggcccccagccgctccgcgctcaaactcgaggaagcctggaaa
gtatttctgccggaggatcgctggctcgactacctgggtggtggcaggaaagccgtcgat
ctgggagccgcgcccggcggttggacctggcaactggtgaaccagggtatgatggtgacg
gctgttgataatggcccgatgaatccggatttgatggccagtgggcatgttgagcacatt
gaggcggatggttatgcctggcgcccgaagcgggcggtcgactggatggtttgcgacata
gtcgataagccgcgccgcaccgcccggatggcagtggactggctggcagacaggctttgc
cgttacacggtattcaacctgaagttaccgatgaagaagcgctacgacgaatggctggta
tgccaggacatcctggtgcgtggtcttgaggaggcgggcctgacttgccgtgtacgggcc
cgccacctttatcatgatcgagaggaaatcacctgttttatcgagcgcctggactaa

DBGET integrated database retrieval system