KEGG   Marinobacter sp. LQ44: ASQ50_19980Help
Entry
ASQ50_19980       CDS       T04470                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mlq  Marinobacter sp. LQ44
Pathway
mlq00480  Glutathione metabolism
mlq00590  Arachidonic acid metabolism
mlq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ASQ50_19980
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ASQ50_19980
Enzymes [BR:mlq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ASQ50_19980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin EF-hand_5
Motif
Other DBs
NCBI-ProteinID: AMQ90781
UniProt: A0A142FWC2
Position
4373609..4374094
Genome map
AA seq 161 aa AA seqDB search
MSGESIYDFSVRDIKGNEASMADYKGKVLLIVNTASKCGFTPQFEGLQALHEELGDQGFE
VLGFPCNQFMNQDPANEDAISQFCSLNYGVSFPMFAKVDVNGDGAHPLFQFLKREAKGLM
GSEKVKWNFTKFLVNRDGQVIRRYAPTAKPADIRADIEKLL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcgaatccatttacgatttcagtgttcgtgacattaagggcaatgaagcctcc
atggcggattacaagggaaaggtcttgctgattgtgaacaccgcgtcaaagtgtggcttc
acacctcaatttgagggcttgcaagcgctgcatgaggaactcggtgaccagggattcgag
gtattgggctttccctgtaaccagttcatgaatcaggatcccgcaaatgaggatgccatc
agtcagttctgttccctgaattacggtgtcagcttcccgatgtttgccaaggttgatgtg
aacggggatggcgcgcatccgctgttccagtttttgaagcgggaagcgaaggggctgatg
ggttctgagaaggtaaagtggaactttaccaagtttctggtcaaccgcgacgggcaggta
atccgccgttacgcacccacagcgaaacccgctgacattcgtgctgatatcgagaagctg
ctctga

DBGET integrated database retrieval system