KEGG   Melampsora larici-populina: MELLADRAFT_114812
Entry
MELLADRAFT_114812 CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00100  Steroid biosynthesis
mlr01100  Metabolic pathways
mlr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MELLADRAFT_114812
Enzymes [BR:mlr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MELLADRAFT_114812
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 18925476
NCBI-ProteinID: XP_007403554
JGI: Mellp1_114812
UniProt: F4R3E8
Position
Unknown
AA seq 424 aa
MKSKETLNPTTLHYEFGGKIGAFGISLSVPFFTYWMNIVCNKSTECRLSYPIFDLPTLWS
QTNLFSLEVCAVYLGWYFYIMTCWCLLPGRRVQGTILRDGSRLTYKINAFATFLCTCALT
AITLWKLGSWPFIYVVDHYVEFITASLIMSVTQAFYCYWSSFRKDRILALGGNSGNFIYD
WFIGRELNPRIGSFDIKTFNEMRPGLILWALLDFCWIIKQFNDFGRVSNSILLTFGFQLW
YVFDAEFNEDTILTQMDITTDGFGFMLSVGDLTWVPFTYSLQLLYLSFTPIDLTLLELGS
IILVQLVGYYIFRVSNEEKNEFRFKKSNPKNLTFIETKRGTKLLTSGWWGRSRHPNYLGD
WIMAWAWCLPTGFQTPITYFYVIYFGILLVHRQLRDEEACAQKYGADWIRYKNIVRWKII
PYIY
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgaaatctaaagaaactctcaatcccaccactttacactatgaatttggtggtaaaata
ggggcctttggaatctctttatcagttcctttctttacctattggatgaacatcgtatgc
aataaatcaacagaatgcaggttatcatatcctatcttcgatctaccaacactatggtct
caaaccaatcttttcagtcttgaagtttgtgcggtttatttaggatggtatttttatatc
atgacttgttggtgtttattaccgggtagaagggttcaaggtacaatcttaagagatggt
tcaagattgacttataaaattaacgcctttgcgactttcttgtgtacctgtgcactgacg
gcaataactctttggaaactcggttcttggccatttatttatgtggtcgatcactacgtt
gagttcatcactgcgagcttaataatgagtgtcacacaagcattttattgctattggagt
agttttcgaaaagatcgaattctagccctaggtggaaatagtggaaattttatatatgat
tggtttatcggacgtgaacttaatccacgtattggttcattcgacatcaaaacgttcaac
gaaatgagaccaggattaatcttatgggctttactagacttttgttggatcatcaaacaa
tttaacgatttcggtagagtatcaaatagcattctgttaacctttgggtttcagttatgg
tatgtttttgatgctgaatttaatgaagatactatcctcactcaaatggatatcactacc
gatggatttggatttatgctctcagttggagatcttacttgggtcccattcacttattct
cttcaattactttacttatccttcacacccatcgatctcaccttattagaattgggatct
atcatattggttcaattagttggatattatatctttcgagttagtaatgaggagaagaat
gaattcagattcaagaagtctaatcccaaaaatctcacgttcattgaaaccaagagaggc
accaagcttttgacatccggttggtggggtcgatcaagacatcctaattacctaggcgat
tggattatggcttgggcctggtgtttaccaactggctttcaaactcccatcacatatttt
tatgtgatttactttggaatcttattggttcatcgtcaacttcgagatgaagaagcttgt
gcacaaaagtatggtgccgattggatcagatacaaaaatatcgttcgttggaaaatcata
ccttatatttattga

DBGET integrated database retrieval system