KEGG   Melampsora larici-populina: MELLADRAFT_42567Help
Entry
MELLADRAFT_42567  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K16944  septin 7
Organism
mlr  Melampsora larici-populina
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mlr04131]
    MELLADRAFT_42567
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mlr04812]
    MELLADRAFT_42567
   04147 Exosome [BR:mlr04147]
    MELLADRAFT_42567
Membrane trafficking [BR:mlr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    MELLADRAFT_42567
Cytoskeleton proteins [BR:mlr04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     MELLADRAFT_42567
Exosome [BR:mlr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MELLADRAFT_42567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase GTP_EFTU ABC_tran Dynamin_N AAA_22 AAA_16 Ras AIG1 AAA_29 Roc AAA_24 RNA_helicase Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 18928051
NCBI-ProteinID: XP_007407332
JGI: Mellp1_42567
UniProt: F4RDI2
Position
Unknown
AA seq 432 aa AA seqDB search
MSEPEEYDPTRQPSPVMNANEPISPPISNIVRKKLMGYVGFANLPNQVHRKSVRKGFSFT
VMVVGESGLGKSTLINTLFNTTLYPPKDYPGPHADRPRTIAIQSISAEIEETGVRLLLTV
VDTPGYGDFVNNSESWKPILDNIEARFDAFLEQENRVNRAKMVDNRVHACIYFIEPTGHS
LKLVDVEFLKRLHTKVNLIPVIAKSDTMTDDEILAFKQRILSDIAFHNIQIYEAPRYEKE
DEETLAENEEIMRKIPFAIVGSDTEVQTADGRQVRGRQYPSGTVEVDNEDHCDFLKLRQM
LIRTHMEELKEHTLNVLYENYRSQKLLSMGVTQDHSVFKEVNPAAKMAEERSLHEAKLSK
MESEMKMVFQQKVAEKEAKLKQSEEELYARHRDMKEALEKQRLELEDKKRRLESGRPLTP
EKTKKKGFLSNR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaccagaagaatacgatcctactcgacagccatctccagtcatgaatgccaat
gaaccaatctcacccccaatatcgaatatcgttcgaaaaaaactaatgggttatgttgga
tttgcaaacttaccaaatcaagtacatcgtaaatcagtccgaaagggcttcagttttact
gttatggttgtgggtgagagtggtctagggaaatcgaccttgatcaacacactcttcaat
actactctctatccaccaaaagattatcctggtcctcatgctgatcgaccaagaacgata
gcgattcaaagcatctcagcagaaatcgaggagacgggtgtaaggctcttactcactgta
gttgatacaccaggttatggtgactttgtcaataactctgaatcatggaaacctatactc
gataatatcgaagctcgtttcgatgcatttcttgaacaagaaaatcgagtgaatcgtgca
aagatggtggataatcgggttcatgcctgtatctatttcattgaacctactggtcattca
ttgaaactagttgatgtagagtttttgaaacgtctacatactaaagttaacttgatcccc
gtcattgctaaatctgatacgatgacagatgatgagatccttgctttcaaacagaggatt
ctatccgatattgcattccacaatattcaaatctatgaagctccccgatatgaaaaagag
gacgaggagactctagctgagaacgaagaaataatgcgaaagatcccattcgccatcgta
ggttcagatacagaagttcaaacagctgatggtcgacaagttcgaggacgacaatatcct
tctggaacagtagaagtcgataacgaagatcattgtgatttcttgaaattaaggcagatg
ctgattcgaacgcatatggaagaattaaaagaacatactcttaatgttctatatgaaaat
tatcgatctcagaaacttttgtccatgggagtgactcaagatcattcagtctttaaagaa
gtcaaccctgcagcgaaaatggcagaagaaagatctttacatgaagctaaattgtccaag
atggaatctgaaatgaagatggtctttcaacaaaaagtagcggaaaaagaagctaaatta
aaacaatcggaagaggaactctatgctagacatcgtgatatgaaagaagctcttgaaaaa
caacgacttgaattggaagataagaaacgtcggctagaatctggtagaccattaacacct
gagaaaactaagaagaaaggattcttgagtaatagatga

DBGET integrated database retrieval system