KEGG   Melampsora larici-populina: MELLADRAFT_44118Help
Entry
MELLADRAFT_44118  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00430  Taurine and hypotaurine metabolism
mlr00460  Cyanoamino acid metabolism
mlr00480  Glutathione metabolism
mlr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    MELLADRAFT_44118
   00460 Cyanoamino acid metabolism
    MELLADRAFT_44118
   00480 Glutathione metabolism
    MELLADRAFT_44118
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mlr01002]
    MELLADRAFT_44118
Enzymes [BR:mlr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     MELLADRAFT_44118
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     MELLADRAFT_44118
Peptidases and inhibitors [BR:mlr01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   MELLADRAFT_44118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 18928157
NCBI-ProteinID: XP_007412025
JGI: Mellp1_44118
UniProt: F4RSF1
Position
Unknown
AA seq 589 aa AA seqDB search
MNDLSSRIQWDRIEPAFNSDYAAFPSRRSVVFGTLGMIASPNPLASSAGIEILNKGGNAA
DAAVATAAVLNVVDPCNCGIGGDAFCLFFNSADQSLKGLNGSGRSPAALSLEKARELGIS
GREIPIKNINSVTVPGSCAAWVDTIKLFGSGRVSLAEVLQPAIRLADEGFPVSEIVSVEW
QRSESLLKAASPNGHEMLLDGQRAPRTGEIMTNKTLAETFKTVAQHGRDGFYRGRISEEI
VKLIKSKGGVMELSDLDSHTSTPVDPISYAYHAANQGGVTLHELPPNGQGLTALMALGIL
ECLEESGVVDMGKMEHNSVEWLHTLIECMRLAFADTRAYVADPSKQDVPVKEMLDKEYLR
SRSKLFDPTKAKANVSRGSPIKTQETVYFTTGDKDGNACSFIMSNYAGFGTGAIPAGCGF
TLQNRGCNFTLDPKHPNCLEPGKRPYHTIIPAMVTRKNDLFLSFGVMGGFMQPQGHLQVL
MNMLHRGFSVQSALDAPRFCISAAMPDATDDQADACDINGEIFLEEGIDQNVAKALTDMG
HQVKIITGPKRGMFGRGQVIQKVVDKNTGRFVWASGSDPRADGQSIAQI
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatctttcgtctcgtatccaatgggaccgaatcgagcctgccttcaattctgac
tatgccgcctttccaagccggcggagcgtcgtcttcggaaccctgggcatgattgcttcc
cctaatcctttagcttcctcagcaggaattgaaatcttaaacaaaggtggcaatgcagca
gatgccgccgtggctaccgctgctgttttgaatgtcgtcgatccttgtaactgtggaata
ggaggggacgccttttgcttattcttcaactcggccgatcagagcctcaagggactcaat
gggagtgggcgaagtccagcagctttgagtctagagaaggctcgcgagttgggcatatct
ggtcgtgagattcctataaagaacatcaactctgttacggtgccaggctcatgtgcagct
tgggtggacacaatcaaactatttggctctggtcgtgtctctttagctgaagtcttgcag
cccgctatacgtctagccgatgaaggatttccagtctcagagattgtgtctgtggaatgg
cagcgttcagagtctcttttaaaggccgccagtccgaatggtcatgagatgcttcttgat
ggtcaacgggcacctcgtactggagagatcatgacgaacaaaacgttagccgaaacattc
aaaacagtggctcagcatgggcgggacggattctatcggggtcgaatctcggaagaaatc
gtgaagttgatcaaatctaagggcggagtcatggaattgtctgaccttgactcgcataca
tccacgcccgtggatccgatctcatacgcctaccatgccgcaaaccaaggcggcgtcacg
ttgcatgagcttccccctaatggacagggactgactgccttaatggctttgggtatactt
gaatgccttgaagagtcgggagtggtggatatgggaaagatggaacacaactcagtagag
tggctacacactttgattgaatgcatgagactagcgtttgcggataccagggcttatgtg
gctgacccatccaagcaagacgtcccggtgaaagaaatgctcgataaagaatacctcagg
agtaggtcgaagcttttcgatcccacgaaagctaaagcgaatgtcagcagaggatctccc
atcaaaactcaggaaacagtttactttaccacaggtgataaggacgggaatgcttgctct
ttcatcatgtcgaattatgccggatttggtactggtgctatacctgctggatgtggtttc
accttacagaatagaggatgtaactttactcttgatccaaaacatcctaattgcttagaa
ccgggaaaacggccataccatacaattatcccagcaatggtcacccgtaagaatgacttg
ttcttgtcctttggcgttatgggaggcttcatgcaaccccaaggccatctgcaagttttg
atgaatatgttgcatcgcggattcagtgttcaatctgctcttgatgcaccgcgcttctgt
atctcagcagccatgcccgatgcaaccgatgatcaggcggacgcgtgtgatataaacggt
gagatattcttggaggaaggaatcgatcaaaatgtggcaaaggcgctcactgacatggga
catcaagtcaagatcatcacgggtcccaaaagggggatgtttggacgaggtcaggtaatt
caaaaggtggtggacaaaaataccggtagatttgtatgggcttctggttcagatccacgt
gctgatggacaatcaattgcacaaatttga

DBGET integrated database retrieval system