KEGG   Melampsora larici-populina: MELLADRAFT_45876Help
Entry
MELLADRAFT_45876  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00020  Citrate cycle (TCA cycle)
mlr00640  Propanoate metabolism
mlr01100  Metabolic pathways
mlr01110  Biosynthesis of secondary metabolites
mlr01130  Biosynthesis of antibiotics
mlr01200  Carbon metabolism
Module
mlr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mlr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MELLADRAFT_45876
   00640 Propanoate metabolism
    MELLADRAFT_45876
Enzymes [BR:mlr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     MELLADRAFT_45876
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MELLADRAFT_45876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 18928284
NCBI-ProteinID: XP_007417815
JGI: Mellp1_45876
UniProt: F4S8X5
Position
Unknown
AA seq 340 aa AA seqDB search
MILNPRACSKVFSRQSIEQTRQFITSTRINSPYDLSIPNLRIHKNTKVICQGFTGKTATY
HCKEALDYGTKFVGGVSPKKAGQHHLGLPVFGSVKDAVRETRPDATVIYVPPPFAADAVI
EAVENEIGLIVCITEGIPQQDEVRIAQVLKSQSKSRLVGPNCPGIMSPDVGGGCKIGIMP
SNIFSPGCIGVVSRSGTLTYEAVDQTTKVGLGQTLCVGIGGDPFPGTQHIDVLKAFMEDD
ATKGIVLIGEIGGSMEEEAAEFLKQYNKTRSVPKPVISFIAGRTAPPGRRMGHAGAIISG
GKGKAEDKVKALEEAGAVVSDSPAKLGALMLKAMKAANLA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgatactcaacccacgagcttgttcaaaagtcttcagtcgccagtcgattgaacagact
cgacaatttatcaccagtactagaatcaatagcccctacgatctttctattccgaatctc
agaatccacaagaacacaaaggtcatatgtcaaggttttactggaaagacagctacatat
cattgtaaagaagcgcttgattacggtaccaagttcgtgggtggtgtgtctcccaagaaa
gctggtcaacatcatctgggacttcctgtttttggaagtgttaaagatgctgtgcgagaa
actagacccgacgcaacagtaatctacgtaccaccgccttttgcggcagatgcagtgatt
gaagcagtggagaatgagattggcttgattgtatgcatcaccgaggggatccctcagcag
gatgaagtcaggatcgcacaagtgttgaagagccagagcaagtcaagacttgtgggccct
aactgtcctggaattatgtcgcctgatgttggtggtggatgcaagattggtatcatgcct
tctaacatcttctcacctggatgtataggtgttgtttcccgatctggtactctcacttat
gaggctgttgaccagactaccaaggtgggactcggtcagacgctttgtgtagggatcgga
ggtgacccattcccaggaactcagcatattgatgttctaaaagcgttcatggaagacgat
gctacaaagggtatcgtgttgattggagaaatcggaggctcgatggaggaagaggcagct
gagttcttgaaacagtacaacaagacacgatcagtaccaaaaccagtgatcagctttatt
gcaggccgaactgcacctccgggtcgtagaatgggtcatgcaggtgctatcattagtggt
ggaaagggtaaagcagaggataaagtaaaggcattggaagaagctggtgcagtcgtcagt
gactcgccagccaaactcggagctttgatgttgaaagcaatgaaagctgcgaatttagct
tga

DBGET integrated database retrieval system