KEGG   Melampsora larici-populina: MELLADRAFT_50198Help
Entry
MELLADRAFT_50198  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00260  Glycine, serine and threonine metabolism
mlr01100  Metabolic pathways
mlr01110  Biosynthesis of secondary metabolites
mlr01130  Biosynthesis of antibiotics
mlr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MELLADRAFT_50198
Enzymes [BR:mlr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     MELLADRAFT_50198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 DUF851
Motif
Other DBs
NCBI-GeneID: 18928679
NCBI-ProteinID: XP_007415725
JGI: Mellp1_50198
UniProt: F4S2V2
Position
Unknown
AA seq 410 aa AA seqDB search
MTQNQTTPTLTNGKHSTKKLVSSLPPTQTGLFEPESNEEKRFLISRDFRSDTMTAPTEDM
FEFMKDASIGDDVYGEDRVTTEFQEKMAQLTGKEAALFCVSGTMTNQLAIRTWLTQPPHS
VLCDARAHIHNYEAGGIAFHSQATTIPVAPSNGHTITLEDIKPMLVLSDDIHFAPTKLVC
LENTIRGLIQPQEEIIKISNYVHELGLILHCDGARIWEVSAKVSQKKKQWKSIGELCEPF
DSMSLCLSKGLGAPIGSVLVGPRAFINKAKWFRKMFGGGIRQCGSIVSAADYCIINNFPT
LSKTHELAQFLSNELIKLGVKIPVPVETNHVFIDPSSIGIDLNQLILRAQSKKIRLGGSR
MIIHIQIKEEAILELISLISEMKLEQQTSNLQIKDDETKNKIRPTFSPYH
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaaatcaaacaacaccaactttaaccaatggaaaacattcaaccaagaaatta
gtttcatcacttccacctactcaaactggtttattcgaacctgaatcaaatgaagaaaaa
agatttttaatctctcgtgactttcgtagtgatactatgactgctcctacagaagatatg
tttgagtttatgaaagatgcttcaattggtgatgatgtttatggagaagatcgagtgacc
actgaatttcaagagaaaatggctcaattgactggtaaagaagccgctttgttttgtgtt
agtggtactatgactaatcaattagccatacgaacttggttgactcagccacctcattct
gtactatgtgatgctagagcgcatattcataactacgaagcaggaggtatagcttttcac
tcacaagccacaaccatcccagtcgcaccctcaaatggtcatacaatcacattagaagat
atcaaaccaatgttggtcctaagtgatgatattcatttcgctccaactaagttggtttgc
ttagaaaatacgattagaggtttgattcaaccacaagaagaaatcatcaagatttcaaat
tatgtacatgaattaggattaattttacattgtgatggtgcaaggatttgggaagtatct
gctaaagtaagtcagaaaaaaaaacaatggaaatcgattggagagctttgtgaaccattt
gattcgatgagtttgtgtttaagtaaaggtcttggtgctcctattggaagtgttctggta
ggaccacgtgcatttataaataaagcaaaatggtttagaaaaatgtttggaggtgggatt
agacaatgtggttcgattgtatcagcagcagattattgtataatcaacaattttccaact
ttatccaaaactcatgaattagctcaattcttatcaaatgaattaatcaaattaggtgtc
aagattccagttccagtagaaactaatcatgtttttattgatccatcatctataggtatc
gatttaaatcaacttatcttacgtgctcaatctaagaagattagattaggtggatcaaga
atgattattcatattcaaattaaagaagaagcaattcttgaattaatttcattaatctct
gaaatgaaattagaacaacaaaccagcaatttacaaattaaagatgatgaaacgaaaaac
aaaatcagacctactttctcaccttaccattga

DBGET integrated database retrieval system