KEGG   Melampsora larici-populina: MELLADRAFT_50986Help
Entry
MELLADRAFT_50986  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00450  Selenocompound metabolism
mlr00970  Aminoacyl-tRNA biosynthesis
mlr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MELLADRAFT_50986
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MELLADRAFT_50986
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mlr01007]
    MELLADRAFT_50986
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mlr03016]
    MELLADRAFT_50986
Enzymes [BR:mlr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MELLADRAFT_50986
Amino acid related enzymes [BR:mlr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MELLADRAFT_50986
Transfer RNA biogenesis [BR:mlr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MELLADRAFT_50986
 Prokaryotic type
   Other AARSs
    MELLADRAFT_50986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 Anticodon_1 KAR9
Motif
Other DBs
NCBI-GeneID: 18928757
NCBI-ProteinID: XP_007418174
JGI: Mellp1_50986
UniProt: F4S9X5
Position
Unknown
AA seq 675 aa AA seqDB search
MACSFILIYIYHSLPLSDRPNILITSALPYVNNAPHLGNIIGSTLSADVYARYRRTGPIP
SQVLYICGTDEYGTTTETKALEEGLSPGALCDKYHQVHKDSYEWFDISFDHFGRTTTPKQ
TEICQEIFTALYNNDHLVEHTVEQVYCNNDQRFLADRFVEGTCPKCGASGARGDQCDTCC
QTLDAIDLIDKKCKICSHSPVTRKSKHLYLNLPKLQKTIESWYSSAKEGKHWSANGKAFT
EAWLRDGLRERCLTRDLKWGVPVPLDGWKDKVMYVWFDAPIGYPSITANYTDDWKKWWKN
PEEVTLYQFMGKDNVPFHTILFPAYLMGTGEKWTMLNHISTTEYLQYENAKFSKSNNIGV
FGQNARETGVPSEVWRYYLISTRPETNDSQFTWTDFIAKANSELLNNLGNFVNRIIKFCN
ARFNSIVPDPLSWPIPGRDEFDQLDQEFVRDIDNLLNQYIESAESLKLRNALAIVMLISA
RGNQYLQDNKIDYNLLLTSPRRCAQIVLVSMNLVYLLSVLVHPFMPTTSDLILKQLNAPQ
RSLPLTFGIDLLPGHMIGEAVYLFRKIDADRGSFWRKQYGGNKVTSNPSGSPAPSKKSQK
KANKSKTNQTTVTYTGPKPDEMIKLEEKIQQQGDEVRKMKAGESEGDLGNELSKLMELKN
QLNEMINSLNATSLN
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcttgttcttttatattgatttatatctatcacagtttacctctttccgatcgtcca
aatatcctcatcacttctgccttgccttatgtcaataacgctcctcatcttggtaacatc
attgggtctactttatcggctgatgtatatgcaagatatcgtagaactggacctatccca
tcacaagtactctatatttgtggaacagatgaatatggaacaactacagagacaaaagcc
ttggaagaaggacttagcccaggagccttgtgtgataaataccatcaagtccataaagat
agttatgaatggttcgatatatcatttgatcatttcgggaggaccactactcctaaacaa
actgagatttgccaagagatctttactgcgctctataacaatgatcacttggttgaacac
acagtcgaacaagtttattgtaacaacgaccaaagatttttggcagaccgttttgtggag
ggcacatgtcccaaatgtggagcatcgggcgctcgaggtgaccaatgtgacacttgttgt
caaacattagacgccatcgacttgatcgacaagaagtgcaagatttgttctcatagtcct
gtcactcgaaaatccaagcatctctacctcaacttacccaagcttcaaaaaaccattgaa
agttggtattcaagtgccaaggaaggaaaacattggtctgcgaatgggaaagcttttacc
gaggcatggctcagggatgggttaagagaacggtgtttgactagggatctcaaatgggga
gtgcctgtgccattagatggttggaaggacaaggtgatgtacgtctggtttgatgcgccg
atcggatatcccagtattactgccaattatacggatgattggaaaaagtggtggaagaac
ccagaagaagtgaccttgtatcaattcatgggaaaagataacgtaccgtttcacaccatc
cttttccctgcgtatctgatggggactggtgaaaagtggaccatgttgaatcatatcagc
acaaccgagtaccttcagtatgaaaatgccaagttttcgaaatctaacaacatcggtgtc
tttggacaaaacgctcgtgaaaccggtgtaccctccgaagtatggcgttattacctaatc
tcaactcgacctgagaccaatgattcacaattcacttggacagatttcattgccaaggcg
aattcagagttattgaacaatttgggtaactttgtgaatcggatcatcaaattctgtaat
gctcgattcaattcgatcgttccagatccattatcatggcctatacctggacgtgatgaa
tttgatcaacttgatcaagaattcgttcgagatatcgataatcttttaaatcaatacatt
gaatctgctgaatctctcaaacttcgaaatgctctagcgattgtgatgttgatttcagct
agaggtaatcaatatttacaagataataagattgattataatctcttactcacttcacca
cgtcgatgtgctcaaatcgtcttggttagcatgaatttggtttacttactttcggtcttg
gtccacccttttatgcccaccacgagtgacttgattttgaaacaacttaacgcacctcaa
cgaagtttaccccttacgtttggaatcgatctcttacctggacatatgattggtgaagca
gtttatctctttagaaagattgacgccgatcgaggttcgttttggagaaaacagtatgga
ggcaacaaagtgactagcaatccgagcggaagtccagccccttcaaagaaaagtcaaaag
aaagccaacaaatcgaaaactaatcaaactactgtcacttatactggacctaaacctgat
gaaatgatcaagttggaagaaaagattcaacaacaaggtgatgaagtacgtaagatgaaa
gcaggagaaagcgaaggagatttaggaaacgagttatctaaattgatggaactcaagaat
caattgaatgaaatgatcaatagtctaaatgcaacgagtttgaattga

DBGET integrated database retrieval system