KEGG   Melampsora larici-populina: MELLADRAFT_53410Help
Entry
MELLADRAFT_53410  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K23856  peroxiredoxin [EC:1.11.1.15]
Organism
mlr  Melampsora larici-populina
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MELLADRAFT_53410
Enzymes [BR:mlr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     MELLADRAFT_53410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA DUF1573
Motif
Other DBs
NCBI-GeneID: 18928863
NCBI-ProteinID: XP_007414313
JGI: Mellp1_53410
UniProt: F4RYY7
Position
Unknown
AA seq 167 aa AA seqDB search
MTSSPLYNLSAPMPNGSEFKFSDTKNKVLLIVNVASKCGFTPQYEGLEKIWQKYKEKDFL
IIAFPSNNFGQQEPGTDAEVASFCKLNYGVTFPIMKKCDVNGDTASEVYKFLKEEKSGLL
GLTRIKWNFEKFLVDRNGHVRYRHASTTKPEALEKEIEELLNESAKA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacttcatcaccactctataacctctctgctcctatgccaaacggctctgaattcaag
ttttcggatacaaagaataaagttttgttgatcgtgaatgtagctagcaaatgtggtttt
actccacagtacgaaggattagaaaagatttggcaaaaatataaagaaaaagatttctta
atcattgcatttcctagtaacaactttggtcaacaagaaccaggaaccgatgcagaagtc
gcaagtttttgtaaattaaattatggtgttactttccctattatgaaaaagtgtgatgtt
aatggtgatacggcaagtgaagtttataagttcttgaaggaagaaaagtctggtttgctt
ggtcttactcgtatcaaatggaatttcgagaaattcttggtggatcgtaacggacacgtt
cgatatcgtcatgcttctacgaccaaacctgaagccttggagaaagaaatcgaagagttg
ttgaacgagtctgccaaagcctaa

DBGET integrated database retrieval system