KEGG   Melampsora larici-populina: MELLADRAFT_53832Help
Entry
MELLADRAFT_53832  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00730  Thiamine metabolism
mlr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    MELLADRAFT_53832
Enzymes [BR:mlr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     MELLADRAFT_53832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 NAD_binding_8 DAO Pyr_redox_2 Lycopene_cycl FAD_binding_2 NAD_binding_9 HI0933_like FAD_oxidored Pyr_redox_3 Trp_halogenase GIDA K_oxygenase FAD_binding_3 V-set_CD47
Motif
Other DBs
NCBI-GeneID: 18928886
NCBI-ProteinID: XP_007416429
JGI: Mellp1_53832
UniProt: F4S4Z4
Position
Unknown
AA seq 338 aa AA seqDB search
MSPPVATEAMYKQTTISHDDHLAALVSKATLATPNTPAKVIFKPEPVENLNPIKFAPIKE
HQVQRAMVRRYFNDMEERAISDVIIVGAGSAGLSCAYALGKARPDLKITILESNVAPGGG
CWLGGQLMSAMVCRKPADEFLDEVGVPYEDEGNFVVVKHAALFTSTVLSKVLAMPNVKMF
NATACEDLIIKPCPINSGAQRVAGCVTNWTLVSLNHDHQSCMDPSTITAPIVCSFAGHDG
PFGAFCVKRIASAGLSEGLGDMRPLDMERAEDHIANKTREIIPGLIVGGMELSEFDGSAR
MGPTFGAMLLSGRRAAEVTMQCLDRVKIEEGEVVGLAA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctccagttgccactgaagccatgtacaaacagactactatctctcatgatgac
catcttgctgctctcgtatcgaaggcaactcttgccacccccaatacacccgctaaggtg
atcttcaagcctgaacctgtcgagaacctgaaccctatcaagtttgctcctatcaaggag
caccaagttcaacgggctatggtccgtcgatacttcaacgacatggaggagcgagctatc
tccgatgtgatcattgtcggtgctggttcagctggtctatcttgcgcctacgcgcttgga
aaggcacgaccggatctcaagatcactatcctcgagagcaatgttgccccaggtggtggt
tgctggctcggtggtcaactcatgagcgccatggtttgccgtaaacctgccgatgagttt
ttggacgaggttggagttccatacgaagatgaaggaaacttcgttgtcgtcaagcacgcc
gctctctttacctccactgtcttgtcaaaggttttggctatgccaaatgtcaagatgttc
aacgctaccgcatgcgaggatttgatcatcaagccatgcccgatcaactcgggagctcaa
cgtgttgctggttgtgtcaccaactggactcttgtctctcttaaccacgatcaccaatcc
tgcatggacccttctaccatcactgctccaattgtctgttcctttgctggacacgatgga
ccattcggtgctttctgtgtcaagcgaattgcatcagcaggtttgagtgaaggtcttgga
gacatgagaccccttgacatggaacgtgccgaagaccacattgccaacaagacccgagag
atcattcctggtcttattgtaggtggaatggaattgagcgagttcgatggaagtgctcgt
atgggaccaacctttggtgctatgcttctctccggtcgccgagctgctgaagttactatg
caatgtcttgaccgagttaaaatcgaagaaggtgaagttgtaggattagctgcttag

DBGET integrated database retrieval system