KEGG   Melampsora larici-populina: MELLADRAFT_86255Help
Entry
MELLADRAFT_86255  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00010  Glycolysis / Gluconeogenesis
mlr01100  Metabolic pathways
mlr01110  Biosynthesis of secondary metabolites
mlr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MELLADRAFT_86255
Enzymes [BR:mlr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     MELLADRAFT_86255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C DXP_synthase_N Peripla_BP_4
Motif
Other DBs
NCBI-GeneID: 18934125
NCBI-ProteinID: XP_007409799
JGI: Mellp1_86255
UniProt: F4RL41
Position
Unknown
AA seq 580 aa AA seqDB search
MPTNSLLSHEDTTIGAYILIRLAQLGIKQVHGVPGDFNLRFLDLIEDHPDLDWVGCCNEL
NASYAADGYARVSKAGIGCLVTTYGVGELSALNGVAGAYAEQVPILHIAGIPSSKMQENK
AIVHHSLGDSNFDTYAKISDFVTCASSALKTPKDAPDEIDRLLKAALTECRPVYLSLPPN
LVDAKIPASNLKIDLRQKVHEELQLQINPKLVPEVLAQISELYLKAKKPMILLDRGCDAF
KVSTEVIKLAESIQIPVYTTLMAKTAIGVHHPLFGGLYKGGSSDIHIKEYVESSDMVIWI
GTVASDRNTSSVSFNFKASEKIELHASHTVVRAKEYPSIGFRTLLPLLTQRLSSLPHKQK
RQIRDSNPPAKIAKQVSMNEMITQAEFWPLWAENFFEPNDIVIGESGTASFALQDVDFPD
GAQLVCQMLWASIGWSTGACLGMAQAAQEQGKRTILFIGDGSLQVSVQEISTMIRAGVKP
IIVVINNDGYVIERFIHGMERKYNDIQPWKWTGILDLFDPENTTPKANYTAETRKEFMDL
FKNPEFRKADRIQLVEAKLGREDAPDGLIQCIKALREKWE
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccaattcgctgctcagtcatgaagatacaactattggggcatatattttgata
cggctggcccaactgggcatcaagcaagtccatggcgttccaggggacttcaatctccga
tttttggatctcattgaagatcacccagatttggattgggtagggtgttgcaatgagctg
aatgcaagttacgccgcggatgggtacgctcgcgtctcaaaagctggcattggatgtctg
gttaccacttacggggttggagagctttcagcgctcaatggcgtagcgggagcatacgcg
gaacaagttccaatcctgcacattgccggaatcccctcgtcaaaaatgcaagagaacaaa
gcgattgtgcatcattctctgggtgacagcaacttcgacacatacgcgaaaatatcggat
ttcgtgacttgtgcttcttcggctctcaagaccccaaaggatgcccctgatgagatcgat
agacttttgaaagccgcgctcaccgaatgtagaccagtttacctgagtctacctcccaac
ctggttgatgccaagattccagcttccaacttgaaaatcgatctgaggcaaaaggttcat
gaagagttacaacttcaaatcaacccgaagttggttcccgaggtccttgctcagatcagt
gaattatatctgaaagctaagaagccaatgatcttgcttgacagaggatgcgatgccttc
aaagtatcaaccgaggtcattaaactggccgaatcaattcagatccctgtctataccacc
ttaatggccaaaactgctatcggagtacatcatccactctttgggggattgtacaaaggc
ggttcgtctgatatacacatcaaagagtatgttgagagctcagatatggtaatttggatc
ggtactgttgcttctgataggaacacctcgagcgtttccttcaacttcaaggcctcagaa
aaaatcgagttacacgcttcacatactgtcgttcgagccaaggaatatccgagcattgga
ttccgaaccttactccctctgctcactcagcgactttcctctttacctcacaaacaaaag
agacaaattcgcgactccaacccacctgcgaagattgcgaagcaggtgtccatgaatgaa
atgatcactcaagccgagttttggcctctttgggctgaaaacttttttgagcctaatgat
atcgttataggtgaatctggcactgcttcgttcgccttacaggacgtggactttccggat
ggagcccagttagtatgccagatgctatgggctagtattggttggtctactggagcctgt
ttgggaatggctcaagctgcacaagagcagggtaaacgtacaatcttgttcatcggtgac
ggcagccttcaagtctccgtccaagagattagtactatgatacgggctggagtgaagcca
atcattgtagtcatcaacaatgatggatacgtgatagagaggtttatccatggcatggag
cgtaaatataatgatatccaaccttggaaatggacaggaatcttagatctctttgaccct
gaaaacactaccccaaaggctaattatacggccgaaactagaaaagaatttatggatttg
ttcaagaaccctgaatttcgaaaagctgatagaattcaacttgttgaggctaaactcggc
agagaagatgcaccagacggcttaattcagtgtatcaaagcccttcgcgaaaaatgggag
tga

DBGET integrated database retrieval system