KEGG   Melampsora larici-populina: MELLADRAFT_86725Help
Entry
MELLADRAFT_86725  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00564  Glycerophospholipid metabolism
mlr00565  Ether lipid metabolism
mlr00590  Arachidonic acid metabolism
mlr00591  Linoleic acid metabolism
mlr00592  alpha-Linolenic acid metabolism
mlr01100  Metabolic pathways
mlr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MELLADRAFT_86725
   00565 Ether lipid metabolism
    MELLADRAFT_86725
   00590 Arachidonic acid metabolism
    MELLADRAFT_86725
   00591 Linoleic acid metabolism
    MELLADRAFT_86725
   00592 alpha-Linolenic acid metabolism
    MELLADRAFT_86725
Enzymes [BR:mlr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     MELLADRAFT_86725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B E1-N
Motif
Other DBs
NCBI-GeneID: 18934279
NCBI-ProteinID: XP_007403509
JGI: Mellp1_86725
UniProt: F4R357
Position
Unknown
AA seq 682 aa AA seqDB search
MAGLLVGAIGISRSRYATKSNCEEKKDSSYGSTIQDWLSIDSMKTQFTSLSSRLSQISSE
LSGDPNSLFQEIVEESINDQKLNPELSWRASVRIGSDIGFCEKGFMRERKHFMRRALASL
IDVDEREIDERDIPVVGIAASGGGYRAMTSTTGCLLGARQSGILDVVSYISGISGSCWAL
AGWYSVAGGNLLDLSNHIKSRITTPFLDLENFQLFTDAPTNKYLLAGPVAKLASKGGTTS
LVDVYGTLVSSRLYVPNDLSRLDPHHLKLSNQRHLLDGSLPLPIYCAIYHQVPDQIQRTN
DSDNAGSSSEKVARDQSFISPSYHWYEMTPYEVGSQDVGAFIPTWALGRAFENGRDVKAR
PEISLSILSGIFASAFTATLAHYYQEVKPGLVMLPFFKAFDAYVSTFESDLSVLHPFPPA
ELPNFLRGLNGQLKPGISAAVTERETLGFMDAGADLNIPYVPLYRRGCDVIISLDASADS
QDVWFSKAETYAQRCGLDTWPIVKYPGSSESAPATEHADHDAEIPLDKSEVAVKKSRVQA
FSQLENEDQKSSDGDEANPFPAETKGAPDSANPEPPLGRCNIWVGDSSNKEISARMDEPN
EEMIRSRDGPALIYIPLAPGNGLDDPAKVWSTWRFDYKEEETEQLLKLSEMNFRSGEQQM
KAVLKAIWKRKRDKRLRMNSES
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcggggttgctagttggagccatcggtatctctagatcaagatacgcgacgaaatcc
aactgtgaagagaagaaagattcctcttatggttctacaattcaagattggttatcaatc
gattcaatgaaaacacaattcacttcactttcatctcgattatctcaaatctcttcggaa
ctttcgggagatcctaattcactttttcaagaaattgtggaagaatctatcaatgatcaa
aaacttaatccagagttatcttggagagcttcagttagaattggatcggatattggattt
tgcgagaaaggttttatgagagaacgtaaacattttatgagacgggcacttgcttcgttg
atagatgtagatgagcgcgaaattgatgaacgcgatattcctgttgttggaatcgccgca
tctggaggtggttatcgtgcgatgacttcgaccacaggctgcttgcttggtgcccgccaa
tcaggcattttggacgtagtcagttatatttcgggaatctctggaagctgttgggctctc
gcaggctggtatagtgtagccggtggcaatcttctcgacttgagcaatcatatcaagagt
cgtatcaccacaccatttttggatttagaaaactttcaactttttacggacgcgcctacc
aataaatatcttctcgcaggcccagtcgccaaacttgccagtaaaggtggtaccacgtca
ttggtggatgtatacggcacattggtctcatcccgcttatatgtacccaacgatctctcg
cgtttggacccacatcatctaaaactttcgaatcagcgccacctacttgatggctctttg
cccttgcctatatactgtgcaatatatcatcaagttccagaccaaattcagcgtacaaat
gattcagacaatgctgggagctcttcggaaaaagtcgctcgtgaccaatcattcatatca
ccttcgtaccactggtatgagatgactccgtatgaagtaggctcacaggatgtcggtgct
ttcattcctacctgggcgctaggacgcgcgttcgaaaacggtcgtgacgtcaaggctcgc
cccgagataagcctttcgattctgagcgggatctttgcttcggctttcaccgccaccctc
gctcactattatcaagaagtcaagcccggtctcgtcatgttaccattcttcaaagctttt
gatgcatacgtgtcaacttttgaatcggatctaagtgtgcttcatccatttccacctgct
gaattgcccaactttcttcgtgggttaaatggtcagcttaagcctggaatctctgcggct
gtgaccgaacgagaaactctggggtttatggatgcgggagcggatcttaacataccctat
gtacctctttatcgacgaggatgcgacgtgatcatctctttggacgcgagtgcagattca
caggatgtttggttttccaaagctgaaacatatgcgcaaagatgtgggctagacacgtgg
ccaatcgtcaaatacccgggctcatcggaatccgcaccagccaccgagcatgccgatcat
gatgctgagattccattggacaagagcgaagtagctgtcaagaagtctcgtgtacaagct
tttagtcaattggaaaatgaagaccaaaagtcttccgatggggacgaagccaatccattt
ccagcagaaaccaaaggtgcccctgacagcgcaaatcccgaaccgcctcttggtcgatgt
aatatatgggtaggagactcttccaacaaagaaatatctgcacgaatggacgagcctaat
gaggagatgatccgatcacgcgatgggcctgctttgatctatattcctctcgctcctgga
aatggactagacgatccggcaaaggtgtggtccacttggcgcttcgattacaaagaagaa
gaaaccgaacagctattgaaattatcagaaatgaatttccgcagtggagagcaacagatg
aaggcggtgttgaaagcgatttggaagcgaaaacgtgataaaagattaaggatgaactca
gaatcttga

DBGET integrated database retrieval system