KEGG   Melampsora larici-populina: MELLADRAFT_88723Help
Entry
MELLADRAFT_88723  CDS       T03138                                 

Gene name
MlpCel7A1.2
Definition
(RefSeq) family 7 glycoside hydrolase
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00500  Starch and sucrose metabolism
mlr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MELLADRAFT_88723 (MlpCel7A1.2)
Enzymes [BR:mlr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     MELLADRAFT_88723 (MlpCel7A1.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7
Motif
Other DBs
NCBI-GeneID: 18934976
NCBI-ProteinID: XP_007419683
JGI: Mellp1_88723
UniProt: F4S1M9
Position
Unknown
AA seq 490 aa AA seqDB search
MNSVLAAVFVYLALASSAHGQLVGTQTPEKPPPLSISSCTKGAGCTEKVRSVTLDANWRW
FHAANGTQNCYKGQDWDPTLCKTGAECTQNCALDGADYSGTYGITSTGSELTLKFITQGP
YSTNVGSRVYLLDTDGTYGMFKLKNQEFSFDVDVSNLPCGLNGALYFTEMPADGGMKKFP
SNKAGSKYGTGYCDAQCPHDIKFIDGKANLDNWTPSKTDKNTGFGAVGSCCTEMDVWEAN
SISQAFTPHTCKGDGPTSCTGKDCGDNPDNRYGGICDKDGCDFASYRLGDRDFYGPKKTV
DSTKKFTVVTQFITSDGTAKGELSEIRRFYIQDGKVIQNSKTKLPGLKKEFDSITGEFCK
AYKGIFGDKDDFTLKGGMKTMSDSMDRGMVLVMSIWDDQMASMEWLDASYPPGKNESTPG
IARGTCNGTSGDPQFVQANSPNASVQFSNIRIGDIGSTNATSNSSAGGDSSQGTQNMQNM
QNMPTTRLRF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaattccgtacttgccgctgtttttgtctatctcgctctcgctagctctgcccatggt
caacttgtcggaactcagacccctgaaaaacctccaccactctcgatctctagctgtacc
aaaggcgctggatgtactgagaaggttcgcagtgtcactcttgatgctaattggcgttgg
ttccatgctgccaatggcactcaaaactgttataaaggtcaagactgggatccgacgctt
tgtaaaaccggcgcggaatgtactcagaattgtgcattggatggagctgattattctgga
acctacggtatcacttccaccggctctgaactcactcttaaattcatcacgcaaggtcct
tactctaccaacgtcggatctcgagtctatctactagacactgatggtacttatggcatg
ttcaagctcaagaatcaagagttctctttcgacgtcgacgtttcgaacttgccatgtggt
ctgaatggtgcactctactttaccgaaatgccggcagatggtgggatgaagaagtttcca
tccaacaaggctggatcgaaatacggtactggttattgtgatgctcaatgtcctcatgac
atcaagttcattgacggaaaggccaacttagataactggaccccatctaagaccgacaaa
aacactggctttggcgcagtcggctcgtgctgtaccgagatggacgtctgggaagccaac
agtatcagtcaagcttttactcctcacacttgcaagggtgatggaccaacaagttgcaca
ggtaaagactgtggtgataatcccgacaaccgatacggtggtatctgtgataaggatgga
tgtgattttgcatcctatcgacttggtgatcgcgacttttacggacctaagaaaactgtc
gattctaccaagaaattcaccgtcgtcactcaatttatcactagtgatggaactgccaag
ggagagctctcggagatccgtcgattttacattcaggatggtaaagtcattcagaacagt
aagaccaagcttccaggtctcaagaaggaatttgactctatcaccggcgagttctgtaag
gcctacaagggtatctttggtgacaaagatgatttcacgcttaagggtgggatgaagaca
atgagtgacagtatggatcgaggaatggtcttggttatgagtatctgggatgatcaaatg
gcatccatggaatggctcgacgccagctaccccccaggaaagaatgagagcactccaggt
atcgctcgtggtacttgtaatggtacttccggtgaccctcaattcgtacaagccaactcc
ccgaacgcctctgttcagttttcaaacattcgaatcggtgacatcggatcgacaaacgct
acgtccaactcctcggctggcggtgactcttcacaaggaacgcagaacatgcaaaacatg
cagaacatgccgaccactcgtcttcgtttctga

DBGET integrated database retrieval system