KEGG   Melampsora larici-populina: MELLADRAFT_89434Help
Entry
MELLADRAFT_89434  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00020  Citrate cycle (TCA cycle)
mlr00620  Pyruvate metabolism
mlr01100  Metabolic pathways
mlr01200  Carbon metabolism
mlr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MELLADRAFT_89434
   00620 Pyruvate metabolism
    MELLADRAFT_89434
Enzymes [BR:mlr01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     MELLADRAFT_89434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-GeneID: 18935188
NCBI-ProteinID: XP_007412362
JGI: Mellp1_89434
UniProt: F4RTB4
Position
Unknown
AA seq 254 aa AA seqDB search
MNANSHLNSAQFIDDDSLDDLPAFDEVELMQPGASSNNSPDMRDYKGCLIMDTTWRDTHQ
SLLATRLRAIDLNIARETSHALANAYSLECWGGATFDVAIRFLSEDPWERLRKIRKLVPN
TPLQALIRGANAVGYTSYPDNAIYEFSKKAVENGLDIFRVFDSLNYLENMKLGIDAAKRA
GGVVEATFCYSHPELPIHVHSHDTAGISLATMLQCAESGADVVDSKRSRDWNPLRRRPSF
ESLLVSMPNALQLF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccaactctcatctcaatagcgctcaatttattgatgatgattcacttgacgac
ttaccagcctttgatgaggttgagctgatgcaacctggagcatcctcaaacaacagtcca
gatatgcgtgattacaaaggatgtttgatcatggacaccacttggcgagacactcatcaa
tctctcctagctacccgtcttcgagccattgatctcaacattgctcgtgaaactagtcat
gctctagccaacgcttactcgcttgaatgttggggaggtgcaacgttcgatgtagcgata
cgattcctctctgaagatccatgggaacgacttcgaaagattcgtaaactagtacctaac
actcctctccaagctttaataagaggagcgaacgcggtgggttatacttcttaccccgac
aatgccatctacgagttttcgaaaaaggctgtcgagaatggcctagatatctttagagtc
tttgattctttgaattatcttgaaaatatgaaactcggtattgatgctgctaaacgagct
ggaggagtggttgaagctacattttgttattcacacccagagttacctatccacgttcac
tctcacgatactgccgggatctcccttgcgacgatgctgcaatgcgctgaatcaggtgcc
gatgtcgttgattcaaaacgatctcgggactggaatccgctacgacgacgtccaagcttt
gaatctctactggtctccatgccgaatgctttacagctgttttga

DBGET integrated database retrieval system