KEGG   Methanosarcina lacustris: MSLAZ_1644Help
Entry
MSLAZ_1644        CDS       T03822                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mls  Methanosarcina lacustris
Brite
KEGG Orthology (KO) [BR:mls00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MSLAZ_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AKB74905
UniProt: A0A0E3WSK9
Position
2092050..2093081
Genome map
AA seq 343 aa AA seqDB search
MDLLVIAIILAGLYMAWNIGANDLANAMGTSVGTGALTIKQVIIIAAVFEFLGAVFFGKR
VTSTIAKGIVPIDIISRVHPDFVVLGMLAAILAASFWITLATFYNLPVSTSHSIVGSVLG
FGLIAAQKGIISYSDIHWDALLKIVASWFISPALGAIFAFLIFSLIRRLYLHKASDMPAV
EKKFIFLQLITACYIAFAHGSNDVANAVGPLSAALNVMGITTGTDVPIWVLVMGGLGMVI
GMATWGYKVVETIGSKITELTPTRGFSAQFATASVVLLHSYSSLPISTTHTLVGSVIGVG
LAGGLAAVDLGVIWKIVSSWIATVPIAALTSAIIFVGLEVIFL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggatttacttgtcatagctattattcttgcaggcttatacatggcctggaacataggg
gcaaacgatctcgcaaatgctatggggacttcggtaggaacgggtgccctaacaatcaag
caggttattatcattgctgcggtgtttgaattcctgggtgccgtgtttttcggaaaacgg
gttacctcgacgattgcaaaagggatagttcccattgatataatcagccgcgttcacccg
gattttgtggtgctggggatgctggctgcaattcttgccgcaagtttctggataacgctc
gcaaccttttacaacctccccgtctcaaccagccattcaattgttggttctgtgctcggc
ttcgggttgattgcagcccagaaaggaattatctcttattctgacatccactgggatgct
cttctgaaaatcgttgccagctggtttatatctccggcccttggagctatttttgcgttt
ctgatcttttctctaataaggaggctctaccttcacaaggcttcagatatgccagctgtt
gagaaaaaattcatattcttacagctcattactgcctgttatatcgcatttgcgcacggg
tcaaacgatgtagcaaacgctgtaggtcctctctctgccgcgcttaatgtgatggggata
acaacaggaactgacgtccctatctgggtgcttgtaatgggtggtcttggcatggtaata
ggaatggcaacctggggctataaagtggtcgaaaccatagggtcaaagatcacggaactc
accccaactcgaggcttttccgcacagtttgcaactgcctcagtggttctgctacacagt
tacagctccctcccgatttcgactactcatacccttgtaggttcggttattggtgtaggg
cttgcaggagggcttgcagccgttgacctgggcgtaatctggaagattgtttcttcctgg
atagcaacagtccccatagctgcccttacatcggcaataatctttgtgggacttgaggtg
atatttttatga

DBGET integrated database retrieval system