KEGG   Methanosarcina lacustris: MSLAZ_3022Help
Entry
MSLAZ_3022        CDS       T03822                                 

Definition
(GenBank) hypothetical protein
Organism
mls  Methanosarcina lacustris
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1616
Motif
Other DBs
NCBI-ProteinID: AKB76283
UniProt: A0A0E3SAL3
Position
3895154..3896041
Genome map
AA seq 295 aa AA seqDB search
MTGKKNSSDILTVIGLVILTDLFVLTPGLSDTVLRNILGLPLVLFLPGYALIAALFPAKS
DLDGIERTALSFGLSIAVVPLIGLGLNYTPWGIRLLPILISLSIFTFAMCGLAYIRRAKL
PEADAFEVPFRKMALELKAEILDKPESGLDKTLTIILVLSILLSVATLFYVVITPKEGEH
FTEFYLLGPEGMADNYPTNYTLGESGTVIVGVVNHEYRPVNYTMEVRLENQSLPLPEDMQ
QVTLAHNETWEKPLTLTPPVAGKDMKLDFLLFNETDKNTPYRDLHLWINVNSTAS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaaaaaaaaattcatcagacatcttgaccgttattgggcttgtgatccttacc
gatctctttgtacttacgcccggattaagtgacactgtgctccgtaatatactgggcctg
cccctcgtacttttcctgcccgggtatgccctgattgctgcactttttcctgcaaaatcc
gaccttgacgggatcgaaaggaccgcactttcctttggactgagcattgcagtcgtgccc
ctgatcggcctcggccttaactatactccctggggaataaggctcctgccaatcctgata
agcctgtcaatattcacatttgcaatgtgcgggcttgcatacataaggcgagcaaagctt
cccgaagccgatgcatttgaggtgcccttcagaaaaatggcgctagagcttaaagccgaa
attctggataaacctgaatcgggactggacaaaactctcaccattattctggtcctgtcc
atcctcctctcggtcgcaacccttttttatgtagttatcaccccaaaagaaggggaacac
ttcacagagttctatcttctggggcctgaagggatggctgacaattacccgacaaattac
acactcggagagagtggaacagtaattgttggagtcgtaaaccacgagtacagaccagta
aattatacaatggaagttagacttgaaaaccagtctctgcctctgcccgaagatatgcag
caggtcacgcttgcccataacgagacctgggaaaagcctctgacgctcacgcctcctgtc
gcgggaaaggatatgaagcttgatttcctgctcttcaacgagaccgacaaaaacacaccc
taccgggacctccacctctggataaatgtaaattcaacagctagttaa

DBGET integrated database retrieval system