KEGG   Muricauda lutaonensis: VC82_15Help
Entry
VC82_15           CDS       T03884                                 

Definition
(GenBank) Isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mlt  Muricauda lutaonensis
Pathway
mlt00020  Citrate cycle (TCA cycle)
mlt00480  Glutathione metabolism
mlt01100  Metabolic pathways
mlt01110  Biosynthesis of secondary metabolites
mlt01120  Microbial metabolism in diverse environments
mlt01130  Biosynthesis of antibiotics
mlt01200  Carbon metabolism
mlt01210  2-Oxocarboxylic acid metabolism
mlt01230  Biosynthesis of amino acids
Module
mlt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mlt_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mlt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VC82_15
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VC82_15
Enzymes [BR:mlt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     VC82_15
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH TFA2_Winged_2
Motif
Other DBs
NCBI-ProteinID: AKA33709
UniProt: A0A0D5YP47
Position
11963..14182
Genome map
AA seq 739 aa AA seqDB search
MSKILYTKTDEAPALATQSLLPIIKSFLKPAHIAIETKDISLAGRIISAFPEYLNKEQQI
SDDLALLGAIAKTPEANIIKLPNISASIPQMKEAIEELQAKGYALPDYPDEPKSEKEKEI
KSRYDKIKGSAVNPVLREGNSDRRAPKAVKNYAKKHPHKMGEWFSGSKTHVATMSSGDFR
NNEKSLTVPAKTEVDIEFIDSKGNKTLLKKGIPLLENEIIDATVMRKEALVNFLREQIAD
AKEEGVLFSVHLKATMMKVSDPIIFGHVVKAYFKDVFDSYGNIFDQLGINANNGLESLFH
KLEGLEKNQRDEIEAAIAKTLHENAPLAMVNSDKGITNLHVPSDVIIDASMPAMIRNSGK
MWNAAGKLQDTKAVIPDSSYAGIYQATIDFCKEHGAFDPRTMGTVPNVGLMAQKAEEYGS
HDKTFEIAQKGTVQVVDTATGKVLLNHEVEEGDIWRMCQVKDAPVQDWVKLAVSRAKATQ
TPAVFWLDENRAHDAELIKKVRRYLKDHYTEGLDIQIMSPVDATYFTLKRLKEGKDTISV
SGNVLRDYLTDLFPILEVGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVEQFLEEGHLRW
DSLGEFLALAVSLEHYGEKNSNQKAKVLANTLDKATETFLENDKSPSRKVNELDTRGSHF
YLALYWAQELAAQDEDTGLKNLFGEISAALSKNEDAINRELLGAQGHPVDIGGYYLPEPG
KLAAAMRPSETLNTILGSL
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattctttataccaagaccgacgaagcaccagcactcgcaacacaatcgtta
ctacccattatcaaatcgtttctcaaaccggcccatattgccattgagaccaaagatatt
tcacttgctggacgtataatttcggctttccctgaatatttgaacaaagaacaacaaata
tccgatgacttggccctgttgggtgccatcgccaaaacacctgaggccaacatcatcaaa
ttacccaatatcagcgcttccattccccaaatgaaagaagccatagaagagttacaggcc
aaggggtatgcactacctgattatcctgatgagcccaagagcgaaaaagaaaaagagata
aaatcccgttacgacaaaataaagggaagtgcggtcaatcctgtgcttcgcgaaggcaac
tccgatagaagggcacccaaggcggttaaaaactatgccaaaaaacatcctcacaaaatg
ggcgaatggttctcaggttccaaaacccatgtagccaccatgtcgagcggggatttcaga
aacaacgagaaatctcttacggtacctgcaaaaaccgaagttgacatcgagttcatcgat
agcaagggcaacaaaacccttttgaaaaaagggattcctcttttagagaatgaaattatc
gatgcgaccgtaatgcgcaaagaagctttggtcaatttcttgagagagcaaatagccgat
gccaaagaggagggtgtgcttttttcagttcatctaaaagcaacaatgatgaaagtctct
gacccaattatcttcggacatgtggtaaaggcttattttaaagatgtcttcgactcctat
ggtaatatcttcgatcaattgggcatcaacgcaaataacggccttgaaagtctttttcat
aaacttgagggtctggaaaaaaatcaaagggacgaaatcgaagcagctattgcaaaaaca
cttcatgaaaacgcaccgctggcaatggttaattccgacaaaggtattaccaacctacat
gttccaagtgatgttatcattgatgcctcgatgcctgccatgattcgcaactctggaaaa
atgtggaatgcagccggtaaacttcaagataccaaggctgtgatcccagacagtagctac
gccggtatttatcaagccaccatcgatttttgcaaagaacatggagcatttgatccacga
acgatgggtaccgtgccaaatgtaggtcttatggcccaaaaggccgaggagtacggttct
cacgacaaaacgtttgaaatagcacaaaaaggcactgttcaagtggtcgatacggcaact
ggcaaagtgcttttgaatcatgaggtcgaagaaggcgatatttggcgcatgtgccaggta
aaggatgctccggtacaagattgggtcaaattggccgtgtcacgggccaaagccacacaa
acacctgctgttttttggttggacgaaaatcgtgcccatgacgccgaactcatcaaaaaa
gtccgtagatacttaaaagaccactatactgaagggttggacattcaaatcatgtcacct
gtggatgccacctattttacattgaaaagattaaaggagggtaaagatactatttctgtt
tccggcaatgtactacgcgattatctgactgacctcttccctattcttgaggtgggcacc
agtgcgaaaatgttgtcaattgttccattgatgaatggtggcggactgttcgagaccggg
gcaggtggctcggcacccaaacacgttgagcaatttttggaagagggccatttacgatgg
gactcccttggggagtttttggcgcttgctgtttcactggagcattacggcgaaaaaaac
agcaaccaaaaagctaaggtcttggccaataccctagacaaggcgaccgaaacgtttttg
gagaacgacaagtcgccctcgagaaaagtcaacgagctcgatacccggggaagccatttc
tatcttgcactctattgggcccaagaacttgccgcgcaagatgaagataccggtcttaaa
aatttgttcggagagatttcagcagcactctcaaagaatgaagacgccattaacagagag
ttgttgggcgcccaagggcatccggttgatattggtgggtactacctcccagagcccggt
aagctggcagcggccatgcgaccaagtgaaacccttaacaccattttgggtagtctttaa

DBGET integrated database retrieval system