KEGG   Muricauda lutaonensis: VC82_2Help
Entry
VC82_2            CDS       T03884                                 

Definition
(GenBank) Chromosomal replication initiator protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
mlt  Muricauda lutaonensis
Pathway
mlt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mlt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VC82_2
DNA replication proteins [BR:mlt03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    VC82_2
Chromosome and associated proteins [BR:mlt03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    VC82_2
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA AFG1_ATPase RNA_helicase ACCA NACHT ATP-cone Nop
Motif
Other DBs
NCBI-ProteinID: AKA33696
UniProt: A0A0D5YPD6
Position
168..1592
Genome map
AA seq 474 aa AA seqDB search
MNVTADSVWNNCLVFIKDNIQPQAFKTWFEPIKPVRLTDNALSIQVPSKFFYEWLEEHYV
KLLKVALTKELGQNAKLVYVIKMENKYGNSEPFTEKIPSSNRSSMDPQELNVPITSKNPQ
LKNPFVIPGIRNIKIESQLNPNYNFENFLEGDSNRLARSAGLAVANKPGGTSFNPLLIFG
GVGLGKTHLAHAIGVEIKDKYPEKTVLYISAEKFTQQYIESVKKNTRNDFIHFYQLIDTL
IIDDVQFLSGKSGTQDVFFHIFNHLHQNGKQVILTSDKAPVDMQDIEQRLLSRFKWGLSA
ELQSPDYETRVSILKNKLYRDGVEMPEEIIDHVAKNIKTNIRELEGAIISLIAQSSFNKK
EVTLELAQQVVEKFVKNTKREVSIDYIQKVVSDYFEMDVATLQSKTRKRHIVQARQLAMF
FAKKYTKASLASIGSQIGKRDHATVLHACKTVDNLAETDKQFRKYLEDLNKKFT
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttactgcagactccgtttggaataactgtttggtctttatcaaagataatatc
caaccgcaggcattcaaaacttggttcgaacccattaaacctgtcaggcttacagacaac
gccctgagcatacaggttcccagcaagtttttttatgagtggctcgaagagcattatgtc
aaattattgaaagtggcgttgaccaaagaattgggccaaaatgccaaattggtctatgtg
atcaagatggaaaacaaatatggcaatagcgagccgttcaccgaaaagatacctagttcg
aacaggtcatcgatggatccacaagaattgaatgtgcccattacctcaaaaaacccccag
ctcaaaaatccgttcgtaataccgggcatacgcaatatcaaaattgagtcacagctcaat
ccaaattataactttgaaaatttcttggagggcgactccaacaggttggcccgttctgcc
ggcttggcagtggcaaacaagcctggtggcacctcgttcaaccccctgttgatatttggc
ggtgttggtttgggcaaaacccacttggcacatgccatcggggtagagatcaaggacaag
tatcctgaaaaaaccgttctctatatttcggcagaaaagtttacccagcagtatattgaa
tcggtaaagaagaacacccgaaacgattttatccatttctaccaattgatagataccctt
atcattgacgatgtgcagtttctatcgggcaaatcgggaacccaagatgtgttcttccac
attttcaaccatttgcaccaaaacggcaaacaggtgatcttgacctctgacaaagcaccc
gttgacatgcaagacatagagcaacgtttgttgtcacgtttcaaatgggggctttcggct
gagctacaaagccccgattacgagaccagggtatccatccttaaaaacaaattgtaccgc
gatggtgttgaaatgcccgaagaaatcatcgaccatgtcgccaaaaacatcaagacgaac
attcgtgagcttgagggtgccattatttcgttgatcgcacagtcatcgttcaacaaaaag
gaagtaaccctggaactggcccaacaagtggtcgaaaagttcgtgaagaataccaaaaga
gaggtttccatcgactatattcaaaaagtcgtgtctgactactttgaaatggatgtggca
accttgcagtcaaagacccgaaaaagacatattgtccaggcgagacaactggccatgttc
tttgcaaaaaaatatacgaaggcctctctggccagtattggttcccaaatcgggaaacga
gaccatgccacggttctgcacgcctgtaaaacggttgacaatcttgctgaaacggataag
cagttcagaaaatatcttgaagacctgaacaaaaaattcacttaa

DBGET integrated database retrieval system