KEGG   Micrococcus luteus: Mlut_03440Help
Entry
Mlut_03440        CDS       T00918                                 

Definition
(GenBank) urease
  KO
K01428  urease subunit alpha [EC:3.5.1.5]
Organism
mlu  Micrococcus luteus
Pathway
mlu00220  Arginine biosynthesis
mlu00230  Purine metabolism
mlu01100  Metabolic pathways
mlu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Mlut_03440
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Mlut_03440
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    Mlut_03440
Enzymes [BR:mlu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     Mlut_03440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Urease_alpha Amidohydro_3 DUF4088
Motif
Other DBs
NCBI-ProteinID: ACS29895
UniProt: C5C8U3
Position
372053..373768
Genome map
AA seq 571 aa AA seqDB search
MSFEISREQYASLYGPTTGDAIRLADTELFAVVEEDLTTPGEEAVFGGGKVIRDGMGQNS
QLVRDVGVPDLVITNVVVIDWTGIYKADIAVRDAHIVAIGKAGNPHTMDGVDIVIGVATD
VISGEGKILTAGGIDTHVHFISPDQIETALSSGLTTMIGGGTGPSESSKATTITPGEWNI
HTMLRSFEHWPMNFGLLGKGHGSSISPMAEQIRAGAIGLKVHEDWGATPSSINTALQVAD
EYDVQVAIHTDTLNESGFVEDTRAAIDGRVIHTFHTEGAGGGHAPDIIELAQYPNILPAS
TNPTLPYTTNTVEEHVDMLMVAHHLNADLPEDVAFADSRIRQETIAAEDVLQDMGIFSMT
SSDSQAMGRVGEVLIRTWQVADSMKRQRGPLPEDEGTAGDNHRIKRYVSKYTINPAIAHG
IADSVGSVEVGKFADLVLWEPQFFGVKPDLVIKGGQMVYGVVGDPNGSIPTPQPRWYRRS
FGAYGQAVHTSAITFMSEASIRAGLPRALGLQKTIRAVHGIRDLTKADMRHNGETPRLEV
DPETYEVRVDGEPVTCEPQDVLPMAQRYFLF
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgagatcagccgcgagcagtatgcgagcctctacggacccaccaccggcgac
gcgatccgcctggcggacaccgagctgttcgccgtcgtcgaggaggacctgaccacgccc
ggcgaggaggccgtcttcggcggcggcaaggtcatccgcgacgggatgggccagaacagc
cagctcgtccgcgacgtcggcgtccccgacctggtgatcaccaacgtcgtggtcatcgac
tggaccggcatctacaaggccgacatcgccgtgcgcgacgcgcacatcgtggccatcggc
aaggccggcaacccacacaccatggacggcgtagacatcgtgatcggggtggccaccgac
gtcatctccggcgagggcaagatcctcaccgccggcggcatcgatacccacgtgcacttc
atcagcccggaccagatcgagaccgcgctctcctccggtctgaccaccatgatcggcggc
ggcaccggtccctccgagtcgtcgaaggccaccaccatcacccccggcgagtggaacatc
cacaccatgctccgctcgttcgagcactggcccatgaacttcggcctgctcggcaagggc
cacggctcctccatctccccgatggccgagcagatccgtgccggcgccatcggcctgaag
gtccacgaggactggggcgccacgccgtcgtccatcaacaccgccctgcaggtggcggac
gagtacgacgtccaggtggccatccacacggacaccctcaacgagtccggcttcgtggag
gacacccgcgccgcgatcgacggccgcgtgatccacacgttccacaccgagggcgccggc
ggcggccacgccccggacatcatcgagctggcgcagtacccgaacatcctgcccgcctcc
accaacccgaccctgccgtacacgacgaacacggtcgaggagcatgtggacatgctcatg
gtggcgcatcacctgaacgcggacctgccggaggacgtggccttcgctgactcccgcatc
cgccaggagaccatcgcggccgaggacgtcctgcaggacatgggcatcttctccatgacc
tcctccgactcccaggcgatgggccgcgtcggcgaggtgctgatccgcacgtggcaggtc
gcggactccatgaagcgtcagcgcggcccgctgcccgaggacgagggcaccgcgggggac
aaccaccgcatcaagcgctacgtgtcgaagtacaccatcaaccccgccatcgcccacggc
atcgccgattcggtcggctccgtggaggtcggcaagttcgccgacctcgtgctgtgggag
ccgcagttcttcggggtgaagccggacctggtcatcaagggcgggcagatggtctacggg
gtcgtgggcgaccccaacggctccatcccgacgccacagccccgctggtaccgcaggtca
ttcggcgcgtacggccaggccgtgcacacctctgccatcaccttcatgtccgaggcgtcc
atccgggccggcctgccgcgcgccctggggctgcagaagaccatccgcgccgtgcacggc
atccgcgacctcaccaaggcggacatgcgccacaacggcgagacgccccgcctcgaggtg
gacccggagacgtacgaggtccgcgtggacggggagcccgtcacgtgcgagccgcaggac
gtcctgcccatggcccagcgctacttcctgttctga

DBGET integrated database retrieval system