KEGG   Micrococcus luteus: Mlut_07350Help
Entry
Mlut_07350        CDS       T00918                                 

Definition
(GenBank) histidinol phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
mlu  Micrococcus luteus
Pathway
mlu00340  Histidine metabolism
mlu00350  Tyrosine metabolism
mlu00360  Phenylalanine metabolism
mlu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mlu00401  Novobiocin biosynthesis
mlu01100  Metabolic pathways
mlu01110  Biosynthesis of secondary metabolites
mlu01130  Biosynthesis of antibiotics
mlu01230  Biosynthesis of amino acids
Module
mlu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mlu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Mlut_07350
   00350 Tyrosine metabolism
    Mlut_07350
   00360 Phenylalanine metabolism
    Mlut_07350
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mlut_07350
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Mlut_07350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mlu01007]
    Mlut_07350
Enzymes [BR:mlu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     Mlut_07350
Amino acid related enzymes [BR:mlu01007]
 Aminotransferase (transaminase)
  Class II
   Mlut_07350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACS30267
UniProt: C5C9W5
Position
797171..798292
Genome map
AA seq 373 aa AA seqDB search
MTDLSSLPLRDNLRGLSPYGAPQLDVPYMLNTNENTHPVPEEVAAAIAERVAAVAGGLNR
YPDREFTGLRRALAGYLGHGLTADHVWAGNGSNEILQQILQAFGGPGRTLLSFLPSYSMY
PLLAGGTDTVFVDGGRAADHTLSAEHAAAMVREHRPHVIFLASPNNPTGTALDLATIEAV
YAAQAQNEAAGGPGAMVVVDEAYAEFALAGTRSALTLLPGRERLIVTRTMSKAFALAGAR
LGYLAADPAVTDALRLVRLPYHLSAVTQATAEAALDHVDALLRTVEDIKAQRDRIVSTLR
GLGLRPSVSDSNFVFFGHLEDASDVWGRLLDRGVLVRDVGIPHHLRVTAGTEPETTAFLT
ALEEVLGETGHRS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctcagctctctgcccctgcgcgataacctccgcggcctgagtccctacggc
gccccccagctggacgtgccgtacatgctcaacaccaacgagaacacgcacccggtgccg
gaggaggtcgccgccgccatcgccgagcgggtcgcggccgtcgccggtgggctgaaccgc
tacccggaccgcgagttcacggggctgcgacgtgcgctcgccggctacctcggccacggc
ctcacggcggaccacgtgtgggccggcaacggctccaacgagatcctgcagcagatcctc
caggccttcggcggccccgggcggacactgctgagcttcctgccctcgtactccatgtac
ccgctgctggccggcggcacggacaccgtgttcgtggacggcggccgcgccgcggaccac
accctcagcgccgagcacgcggcggccatggtgcgggagcaccgcccgcacgtcatcttc
ctggcctcccccaacaacccgacgggcacggccctggacctggcgaccatcgaggccgtg
tacgccgcgcaggcgcagaacgaggccgccggcgggcccggcgcgatggtcgtcgtggac
gaggcctacgcggagttcgccctcgccggcacccgctccgccctcacgctcctgcccggc
cgcgagcggctgatcgtcacgcgcaccatgtccaaggcgttcgccctggccggcgcgcgc
ctgggctacctggccgcggaccccgccgtcaccgacgccctgcgcctggtgcgcctgccg
taccacctctccgcggtcacgcaggccacggcggaggccgccctcgaccacgtggacgcg
ctgctgcgcaccgtggaggacatcaaggcccagcgcgaccgcatcgtctccaccctgcgc
ggcctgggactgaggccctcggtgtccgactcgaacttcgtcttcttcggtcacctcgag
gacgcgtccgacgtgtggggccgactgctcgaccgcggcgtgctcgtgcgggacgtcggc
atcccgcaccacctgcgcgtcaccgccggcaccgagccggagacgacggcgttcctgacc
gctctcgaggaggtcctcggcgagaccgggcaccggtcctga

KEGG   Micrococcus luteus: Mlut_20100Help
Entry
Mlut_20100        CDS       T00918                                 

Definition
(GenBank) aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
mlu  Micrococcus luteus
Pathway
mlu00340  Histidine metabolism
mlu00350  Tyrosine metabolism
mlu00360  Phenylalanine metabolism
mlu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mlu00401  Novobiocin biosynthesis
mlu01100  Metabolic pathways
mlu01110  Biosynthesis of secondary metabolites
mlu01130  Biosynthesis of antibiotics
mlu01230  Biosynthesis of amino acids
Module
mlu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mlu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Mlut_20100
   00350 Tyrosine metabolism
    Mlut_20100
   00360 Phenylalanine metabolism
    Mlut_20100
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mlut_20100
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Mlut_20100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mlu01007]
    Mlut_20100
Enzymes [BR:mlu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     Mlut_20100
Amino acid related enzymes [BR:mlu01007]
 Aminotransferase (transaminase)
  Class II
   Mlut_20100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Met_gamma_lyase CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ACS31484
UniProt: C5C6Z6
Position
complement(2170192..2171292)
Genome map
AA seq 366 aa AA seqDB search
MVAPHKKVGMLPPYAAGKPPVAVPGLQPYKLSSNENPFAPVPGVIERVREVVTGPEGAPS
TLCRYPDTLSTGLRQALAAHLDVPADDVVTGAGSLGALAQVITTFAGHGEASEGDEVIFA
WRSFEAYPIVVRTAGAVDVQVPLTADHRHDLPAMLDAITERTRVILLCTPNNPTGPVLTT
AEVEDFLARVPEHILVVIDEAYVEFVRDEDAVKGLDMYRKHANVVVLRTFSKAHGLANLR
VGYSVSQPEITKALRTVATPFAVSTVAEEAAIASLEHLDEVLERVQVVVDERERVAAALA
EAGWDLPASQANFVWLPLGERTQEFAEAAQAQALSVRAFAGEGVRVSIGEVEANDRFLEV
ARDFLK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgccccgcacaagaaggtcgggatgctcccgccgtacgctgccggcaagccgccg
gtcgcggtcccgggcctgcagccctacaagctctcgtcgaacgagaacccgttcgccccc
gtgcccggcgtgatcgagcgggtgcgcgaggtcgtgaccggcccggagggcgcgcccagc
acgctctgccgctacccggacaccctctccaccggcctgcgccaggccctggccgcgcac
ctggacgtcccggcggacgacgtcgtgaccggcgccggctccctcggcgccctggcccag
gtcatcaccactttcgccggccacggcgaggccagtgagggcgacgaggtgatcttcgcg
tggcgcagcttcgaggcctacccgatcgtggtgcgcaccgccggcgccgtggatgtgcag
gtgccgctcaccgcggaccaccgccacgacctgccggccatgctggacgcgatcaccgag
cgcacgcgggtgatcctgctctgcacccccaacaacccgaccggccccgtgctcaccacc
gccgaggtcgaggacttcctggcgcgcgtgcccgagcacatcctggtggtcatcgacgag
gcctacgtggagttcgtccgggacgaggacgcggtcaagggcctggacatgtaccgcaag
cacgcgaacgtcgtcgtgctgcgcaccttctcaaaggcccacggcctggccaacctgcgc
gtgggctactcggtctcgcagccggagatcacgaaggccctgcgcaccgtggccaccccg
ttcgcggtgtccacggtggccgaggaggctgcgatcgcctcgctcgagcacctggatgag
gtcctcgagcgcgtgcaggtcgtcgtcgacgagcgcgagcgcgtcgccgccgccctggcc
gaggccggctgggacctgcccgcctcgcaggccaacttcgtgtggctgccgctcggcgag
cgcacgcaggagttcgccgaggccgcccaggcccaggccctgtccgtccgggcgttcgcg
ggcgagggcgtgcgcgtgagcatcggcgaggtcgaggccaacgaccgcttcctggaggtc
gcgcgcgacttcctgaagtga

DBGET integrated database retrieval system