KEGG   Micrococcus luteus: Mlut_07590Help
Entry
Mlut_07590        CDS       T00918                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mlu  Micrococcus luteus
Pathway
mlu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mlut_07590
Enzymes [BR:mlu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Mlut_07590
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Mlut_07590
    1.1.1.-  
     Mlut_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ACS30291
UniProt: C5C9Y9
Position
818765..819838
Genome map
AA seq 357 aa AA seqDB search
MTMRAARWHGKKDIRIEEIDSPTAGPGQVLVDVAWCGICGTDLHEYLEGPIFIPPAGHPH
PISGDAAPVTLGHEMSGTVAALGEGVTDLEVGQKVVVEPYIVREEDQDRPDYNLAPDMNF
IGLGGDGGGLAEQIAVRRRWVHPVADSVPLDQAALIEPLSVAHHAWVRAGSPTSGVAVIG
GAGPIGALTAAVLKGKGLTVYVSELSELRRQKVLEAGVVDEAFDPREVDVPAKIRELHDG
QGADVGFECTSVDVVLDMLLDAVRPGGVIVNESIWGHEPAVALHKLVMKEIDLRGTIAYA
NDHADTIRMVEDGAVDLAPFITGKIGLDDLVDQGFETLIHHNETAVKILVSPTGQGL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgcgcgccgcccgttggcacggcaagaaggacatccgcatcgaggagatcgac
tcgcccacggccggtccagggcaggtcctcgtggacgtcgcgtggtgcggcatctgcggc
acggacctgcacgagtacctcgagggtccgatcttcatcccgccggccggacacccgcac
ccgatctccggtgacgccgcccccgtcacgctcggccacgagatgtccggcaccgtcgcc
gccctgggcgagggcgtcacggacctcgaggtcggccagaaggtcgtcgtggaaccgtac
atcgtgcgcgaggaggaccaggaccgaccggactacaacctcgcgccggacatgaacttc
atcggcctgggcggcgacggcggcggcctggccgaacagatcgcggtgcggcgccgctgg
gtccaccccgtggccgactccgtgcctctcgaccaggccgcgctcatcgagccgctctcc
gtggcccaccacgcgtgggtgcgggccggctctccgacgtcgggcgtggccgtgatcggc
ggcgccggccccatcggcgcgctcaccgcggctgtgctcaagggcaagggcctgacggtg
tacgtctccgagctctccgagctgcggcggcagaaggtgctcgaggccggcgtggtggac
gaggccttcgacccccgcgaggtggacgtgcccgccaagatccgcgaactgcacgacggc
cagggcgcggacgtgggcttcgagtgcacctcggtggacgtggtgctggacatgctgctg
gacgcggtgcgtcccggcggcgtgatcgtcaacgagtccatctggggccacgagcccgcc
gtggccctgcacaagctggtgatgaaggagatcgacctgcgcggcaccatcgcgtacgcg
aacgaccacgcggacaccatccgcatggtcgaggacggcgccgtggacctcgcgccgttc
atcaccggcaagatcggcctcgacgacctggtcgaccagggcttcgagaccctcatccac
cacaacgagacggccgtgaagatcctcgtctcgccgaccggtcagggtctctga

DBGET integrated database retrieval system