KEGG   Micrococcus luteus: Mlut_08440Help
Entry
Mlut_08440        CDS       T00918                                 

Definition
(GenBank) malate:quinone-oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mlu  Micrococcus luteus
Pathway
mlu00020  Citrate cycle (TCA cycle)
mlu00620  Pyruvate metabolism
mlu01100  Metabolic pathways
mlu01110  Biosynthesis of secondary metabolites
mlu01120  Microbial metabolism in diverse environments
mlu01130  Biosynthesis of antibiotics
mlu01200  Carbon metabolism
Module
mlu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mlu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mlut_08440
   00620 Pyruvate metabolism
    Mlut_08440
Enzymes [BR:mlu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Mlut_08440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 DUF2298
Motif
Other DBs
NCBI-ProteinID: ACS30372
UniProt: C5CAA3
Position
complement(911287..912771)
Genome map
AA seq 494 aa AA seqDB search
MPTTSSTATHDVVLIGGGIMSATLGVLLQKLEPTWSIALYENLDQAGLESSDPWNNAGTG
HAALCELNYSPMDKNGRVDVTKALGINEQFWITRQFWSSLVVDGTLKDPKSFINPLPHMS
FVWGDDHADYLRARYEAMSAQPVFAGMEHSEDPEQIRAWAPLLIEGRESGQRLAASRHTG
GTDVDFGSLTRQLVTAMAGAGAEVRFGHKVTGLTRGTDGRWEVKVKNKAAGSEVVDRARF
VFVGAGGGALPLLQKSGIPEIKGFGGFPVSGQFLRCTDESVVNQHMAKVYGQAAVGAPPM
SVPHLDTRFVNGKRSLLFGPYAGFSTNFLKTGSYLDLPLSVRPHNLTTMLDVAKDNVDLT
KYLVTEVLKSRDKKIDALHEFYPEADGGEWELITAGQRVQVMKRKGRFGGVLQFGTEVVT
HADGSLGGLLGASPGASTAAPIMVKLLERCFPAKTAGWDGTLKELIPSLGHTLNDDPALL
DEVRTVTDAALKLA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaccacctcgtccaccgccacccacgacgttgtcctgatcggcggcggcatcatg
agcgccaccctgggcgtgctgctgcagaagctcgagcccacctggtccatcgccctgtac
gagaacctcgaccaggccggtctggagtcctctgacccgtggaacaacgcgggcaccggc
cacgccgccctctgcgagctgaactactcgcccatggacaagaacggccgggtggacgtc
accaaggcgctgggcatcaacgagcagttctggatcacccgccagttctggtcctccctg
gtggtggacggcacgctcaaggaccccaagtccttcatcaacccgctgccgcacatgtcc
ttcgtgtggggcgacgaccacgccgactacctccgcgcccgctacgaggccatgtccgcc
cagccggtgttcgccggcatggagcacagcgaggacccggagcagatccgcgcctgggcc
ccgctgctgatcgagggccgcgagtcgggccagcgcctggcggcgtcccgccacacgggc
ggcaccgatgtggacttcggctccctcacccgccagctcgtcacggccatggccggcgcc
ggcgccgaggtgcgcttcggtcacaaggtcaccggcctcacccgcggcacggacggccgc
tgggaggtcaaggtcaagaacaaggccgccggttccgaggtcgtggaccgcgcccgcttc
gtcttcgtcggtgccggcggcggcgccctgcccctgctgcagaagtccggcatccccgag
atcaagggcttcggcggcttcccggtctccggccagttcctgcgctgcacggacgagtcc
gtggtcaaccagcacatggccaaggtgtacggccaggccgccgtcggcgcccccccgatg
tccgtgccccacctggacacccggttcgtcaacggcaagcgctccctgctgttcggcccc
tacgccgggttctccacgaacttcctcaagaccggctcctacctggacctgccgctgtcc
gtgcgcccgcacaacctcaccacaatgctggacgtggccaaggacaacgtggacctgacc
aagtatctcgtgaccgaggtgctgaagtcccgggacaagaagatcgacgcgctgcacgag
ttctacccggaggccgacggcggcgagtgggagctgatcaccgcgggccagcgcgtgcag
gtgatgaagcgcaagggccgtttcggcggcgtcctgcagttcggcaccgaggtcgtcacc
cacgcggacggctcgctcggcggcctgctcggcgcctcgccgggcgcctccaccgctgcc
cccatcatggtgaagctgctcgagcgctgcttccccgcgaagacggccggctgggacggc
acgctcaaggagctcatcccgtcgctgggccacacgctcaacgacgacccggcgctgctg
gacgaggtccgcaccgtcacggacgccgcactgaagctggcctga

DBGET integrated database retrieval system