KEGG   Micrococcus luteus: Mlut_20240Help
Entry
Mlut_20240        CDS       T00918                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
mlu  Micrococcus luteus
Pathway
mlu00360  Phenylalanine metabolism
mlu00362  Benzoate degradation
mlu00650  Butanoate metabolism
mlu01100  Metabolic pathways
mlu01120  Microbial metabolism in diverse environments
mlu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mlut_20240
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Mlut_20240
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mlut_20240
Enzymes [BR:mlu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     Mlut_20240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH F420_oxidored TrkA_N Shikimate_DH Sacchrp_dh_NADP NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACS31498
UniProt: C5C710
Position
2185021..2185908
Genome map
AA seq 295 aa AA seqDB search
MTDQQHTPDTAPSSVPAVVGVLGGGRMGGGIAHAFLVAGSSEVVVVERDPQSAEAARERI
EADLAASLERGKIDGDLDEWAQRLTVSVDRADFARCDLVVEAVFEDMQVKIEALTDVEAH
LREDAWLASNTSSLSIDEIATHLQRPERFCGLHYFNPVPASKLVEVVIGEQTGAELQALS
TECVRGLGKTPVVVKDAPGFASSRLGVAIALEAIRMVEEGVASPEDIDAAMVLGYKFPVG
PLALTDIVGLDVRLGIAEYLESQLGERFAPPQLMRDMVARGELGRKSGKGFFDYR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcagcagcacacccctgacaccgcgccgtcctccgtgcccgccgtcgtcggc
gtcctcggcggcggccggatgggtggcggcatcgcccacgcgttcctcgtcgccggttcg
tccgaggtggtcgtcgtcgagcgcgacccacagtcggccgaggccgccagggagcgcatc
gaggccgacctggccgcctccctcgagcgcggcaagatcgacggcgacctggacgagtgg
gcgcagcgcctgaccgtctccgtggaccgcgccgacttcgcccgctgcgacctcgtggtc
gaggccgtgttcgaggacatgcaggtgaagatcgaggcgctcaccgacgtcgaggcacac
ctgcgcgaggacgcctggctggccagcaacacctcctccctgtccatcgacgagatcgcc
acgcacctgcagcgccccgagcgcttctgcggcctgcactacttcaacccggtgcccgcc
tcgaagctcgtggaggtcgtgatcggcgagcagaccggtgcggagctccaggccctgtcc
accgagtgcgtccgcgggctcggcaagacccccgtcgtcgtcaaggacgccccgggcttc
gcctcgtcgcgtttgggcgtggcgatcgcgctcgaggccatccgcatggtcgaggagggt
gtggcctcccccgaggacatcgacgccgccatggtgctcggctacaagttcccggtcggc
ccgctggccctgaccgacatcgtgggcctggacgtgcgcctgggcatcgcggagtacctc
gagtcccagctgggtgagcgtttcgccccgccgcagctcatgcgggacatggtggcccgc
ggcgagctcggccggaagtccggcaagggcttcttcgactaccgctga

KEGG   Micrococcus luteus: Mlut_20300Help
Entry
Mlut_20300        CDS       T00918                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
mlu  Micrococcus luteus
Pathway
mlu00360  Phenylalanine metabolism
mlu00362  Benzoate degradation
mlu00650  Butanoate metabolism
mlu01100  Metabolic pathways
mlu01120  Microbial metabolism in diverse environments
mlu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mlut_20300
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Mlut_20300
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mlut_20300
Enzymes [BR:mlu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     Mlut_20300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH AlaDh_PNT_C NAD_binding_2 NAD_Gly3P_dh_N 2-Hacid_dh_C F420_oxidored LPD22 UDPG_MGDP_dh_N Ribosomal_S7
Motif
Other DBs
NCBI-ProteinID: ACS31504
UniProt: C5C716
Position
2191073..2192005
Genome map
AA seq 310 aa AA seqDB search
MSEFTRFEQVAVLGTGVLGSQIIMQAAYHGKKVMAYDAVPAALEGIERRWAWIRQGYEAD
LGEGYDPQRFDEAIARITPTSDLGEALADADIVIEAVPENLELKRKVWAQVGELAPATTL
FATNTSSLLPSDFADASGHPERFLALHYANRIWAQNTAEVMGTAATSPEAVAGALQFAEE
TGMVPVHVRKEIPGYFLNSLLIPWLQAGSKLYMHGVGNPADIDRTWRVATGNERGPFQTY
DIVGFHVAANVSRNTGVDWQLGFAELLEKSIAEGHSGVADGQGFYRYGPDGENLGPVEDW
NLGDKDTPLG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagttcacccgtttcgagcaggtcgccgtgctgggcaccggcgtgctgggttcg
cagatcatcatgcaggcggcgtaccacggcaagaaggtgatggcctacgacgccgtcccc
gccgccctcgaggggatcgagcgccgctgggcgtggatccgccaaggctacgaagcagac
ctcggggagggctacgacccgcagcgcttcgacgaggccatcgcccgcatcacgccgacc
tccgacctcggcgaggccctggcggatgcggacatcgtgatcgaggccgtcccggagaac
ctggagctcaagcgcaaggtgtgggcccaggtgggcgagctcgcccccgccacgaccctg
ttcgccacgaacacctcctccctgctgccctcggacttcgccgacgccagcggccatccg
gagcgcttcctggccctgcactacgccaaccgcatctgggcgcagaacaccgccgaggtc
atgggcaccgccgccacctcgccggaggccgtcgcgggagccctgcagttcgccgaggag
accggcatggtccccgtgcacgtgcgcaaggagatcccgggctacttcctcaactccctg
ctcatcccgtggctgcaggccggctccaagctgtacatgcacggagtgggcaacccggcg
gacatcgaccgcacctggcgcgtggccaccggcaacgagcgcggcccgttccagacctac
gacatcgtgggcttccacgtggccgccaacgtctcccgcaacacgggcgtcgactggcag
ctcggcttcgctgagctgctcgagaagagcatcgccgagggccacagcggcgtggctgac
ggccagggcttctaccgctacgggccggacggggagaacctcggcccggtggaggactgg
aacctgggcgacaaggacaccccgctcggctga

DBGET integrated database retrieval system