KEGG   Methanosarcina mazei Go1: MM_0255Help
Entry
MM_0255           CDS       T00082                                 

Definition
(GenBank) N5-methyl-tetrahydromethanopterin:coenzyme M methyltransferase subunit A
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00680  Methane metabolism
mma01100  Metabolic pathways
mma01120  Microbial metabolism in diverse environments
mma01200  Carbon metabolism
Module
mma_M00357  Methanogenesis, acetate => methane
mma_M00567  Methanogenesis, CO2 => methane
mma_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MM_0255
Enzymes [BR:mma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MM_0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA
Motif
Other DBs
NCBI-ProteinID: AAM29951
UniProt: Q8Q082
Position
340711..341229
Genome map
AA seq 172 aa AA seqDB search
MVTLASHLDACPDAAIWGSSKTENLGVEKIIVNVISNSNIRYVLVCGTESRGHLAGHSLL
AIHANGIDEQGRITGSQGAIPFIENISGTAVERFQQQVTVLNRIGLNDPEEIRRIVEDYR
DKGEAYPEEPMLVCAPKKRQTSFAVPTSGDVIISGEFVMDSKAGIIYTAESL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtggtaactcttgcaagccaccttgatgcctgccctgatgctgctatctggggcagttca
aaaaccgaaaacctgggagtagaaaagataatagtaaatgtaatttcaaactccaatatc
aggtacgtcctggtctgcggaaccgagtcaagaggccacctggcagggcattctctcctc
gcaatccatgcaaacggaattgatgaacagggcaggattaccggttcacagggagcaatt
ccctttatagaaaacatatccggaactgcagtcgaacgcttccagcagcaggttacagtt
ctcaatagaattgggctgaatgaccctgaagagatcaggaggattgttgaggactacagg
gataaaggagaagcgtaccctgaagagcccatgctcgtctgcgctcctaaaaaaaggcag
acttcttttgcagtccccacttcaggagatgtaataatttcaggggaattcgtaatggat
tcaaaagcaggaataatctatactgcggaaagcctctga

DBGET integrated database retrieval system