KEGG   Methanosarcina mazei Go1: MM_0603Help
Entry
MM_0603           CDS       T00082                                 

Definition
(GenBank) Nucleoside-triphosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:mma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MM_0603
Enzymes [BR:mma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     MM_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like DUF4224
Motif
Other DBs
NCBI-ProteinID: AAM30299
UniProt: Q8PZ91
Position
735435..735989
Genome map
AA seq 184 aa AA seqDB search
MHKIVFVTGNKGKFAEVRDILKNFGIEAIQNKDGYPELQEDELEPIAANGAQYVANKLNM
PVMVDDSGIFINALNGFPGPYSRFVEDKLGNPKVLKLMEGEKDRSAYFKTVIGYCEPGQE
PLVFPGVVEGKIAYEERGTGGFGYDPIFEYNGMTFGELGDEEKNKVSHRRRAVDNFLEWF
IGGA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcataagatcgtttttgttacgggaaataaaggcaaatttgccgaggtgagggatatc
ctcaagaatttcggaatcgaagccatccagaataaagacggttatcccgaactccaggaa
gatgaacttgaacctatcgctgctaacggggcacagtatgttgcaaacaaactgaacatg
cccgtaatggtagacgactcaggaatattcataaatgccctgaacggctttccgggaccc
tattcccgctttgtggaagacaaactggggaacccgaaagtgctgaagctcatggaagga
gagaaagacaggtcagcgtatttcaaaaccgtgattggatattgtgaaccgggacaggag
cctctggtcttccccggggtcgtggaagggaagatcgcatacgaagagcgcggaacaggc
ggtttcggttacgaccctattttcgagtataacggcatgaccttcggggaactcggggat
gaagagaaaaacaaggtttcccataggcgcagggctgttgataatttcctggagtggttc
ataggcggggcgtaa

DBGET integrated database retrieval system