KEGG   Methanosarcina mazei Go1: MM_1133Help
Entry
MM_1133           CDS       T00082                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00040  Pentose and glucuronate interconversions
mma00052  Galactose metabolism
mma00500  Starch and sucrose metabolism
mma00520  Amino sugar and nucleotide sugar metabolism
mma01100  Metabolic pathways
mma01130  Biosynthesis of antibiotics
Module
mma_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MM_1133
   00052 Galactose metabolism
    MM_1133
   00500 Starch and sucrose metabolism
    MM_1133
   00520 Amino sugar and nucleotide sugar metabolism
    MM_1133
Enzymes [BR:mma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MM_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Smr IspD Glycos_transf_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAM30829
UniProt: Q8PXT3
Position
complement(1336385..1337356)
Genome map
AA seq 323 aa AA seqDB search
MGEKYFNSEEYNLTEFLFIGELTLTIKKALIPAAGLGTRFLPATKSMPKEMLPIIDTPVI
QYVVEEAIASGIEDIIIITGRGKRAIEDYFDDSPELEMHLAKKHQTDMLKLVRDISSLVD
IHYIRQKEPNGLGDAVLRAENHIGDEPFAVLLGDDIIVNDKPCTAQLIENFEKYGRSTIA
VEEVPYEKLSSYGIIKGKPLDDSLYVLEDIVEKPAPEDAPSNIGAIGRYVFTPEIFDCIK
HAGTGVGSEIQLTDGIRLLNKSQMIYACRFKGKRFDTGDRLGYVKSIVDFALQNENLRDD
VLEYLREILAVNKISPEIDKLKQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaaagtactttaactcagaagaatacaaccttacagaatttcttttcattgga
gaattaaccttgactatcaaaaaagcacttatcccggcagccggtcttgggactcgcttt
ctgccggcaacaaagtcaatgccaaaagaaatgcttcctataattgacacacctgtaatt
cagtatgtagtggaggaagctattgcctcaggcatagaagatattattattattacaggc
aggggcaagagagcaattgaggactacttcgatgattctccggaacttgagatgcatctt
gctaaaaaacaccagacagatatgctgaaactggtccgggacatctcttctcttgtagat
atccactacatccgccagaaagagcccaatgggcttggagatgcggtattaagggcagaa
aaccatatcggagacgagccttttgcggtgcttctcggagacgatattatcgttaacgac
aaaccctgcactgcccagcttattgagaactttgagaaatacgggaggtcaacaatcgca
gttgaagaggtcccttacgaaaaactgagcagttatggaattataaaaggcaagcccctc
gatgattccctttatgttcttgaagacattgtagaaaaaccagcacctgaagatgctcct
tccaatataggagcaatagggcgctatgtattcacgcctgagatttttgactgcataaag
catgccggtactggcgttggaagtgaaatacagctcacagacggtatcaggctccttaac
aaatcccagatgatctatgcctgcagatttaagggaaaaaggttcgatacaggagaccgg
ctcgggtacgtaaaatccatagtcgattttgctctccagaacgaaaacctcagggacgat
gtgcttgaataccttcgggaaattctcgcagttaataagatttctccagaaatagataag
ttaaaacaataa

DBGET integrated database retrieval system