KEGG   Methanosarcina mazei Go1: MM_1339Help
Entry
MM_1339           CDS       T00082                                 

Definition
(GenBank) pyruvate synthase beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00010  Glycolysis / Gluconeogenesis
mma00020  Citrate cycle (TCA cycle)
mma00620  Pyruvate metabolism
mma00633  Nitrotoluene degradation
mma00640  Propanoate metabolism
mma00650  Butanoate metabolism
mma00680  Methane metabolism
mma00720  Carbon fixation pathways in prokaryotes
mma01100  Metabolic pathways
mma01120  Microbial metabolism in diverse environments
mma01130  Biosynthesis of antibiotics
mma01200  Carbon metabolism
Module
mma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MM_1339
   00020 Citrate cycle (TCA cycle)
    MM_1339
   00620 Pyruvate metabolism
    MM_1339
   00640 Propanoate metabolism
    MM_1339
   00650 Butanoate metabolism
    MM_1339
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MM_1339
   00680 Methane metabolism
    MM_1339
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MM_1339
Enzymes [BR:mma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MM_1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AAM31035
UniProt: Q8PX83
Position
complement(1603171..1604061)
Genome map
AA seq 296 aa AA seqDB search
MSKAAPKTYLASGHSGCAGCCDAFAAKFTLMGAGPNCIVVNPTGCLEVMTTPFPNSAWQV
PWIHSLFENAGAVASGVEAALIALGKKNDTKVISIGGDGSTMDIGIRSLSGAFERGHDFT
YVCMDNEAYMNTGIQRSSGTPFDASTTTSPPGKFSFGNPRPKKDMVAIMAAHGSPYVATT
SIGYPRDMIRKVKKATEIVGPTYIHAHAPCTTGWGFDTSKTLEVAKLAVETCLWPMYEME
NGEITQVRKVKDPKPVEDYLRVQKRFKHLFTMEGGEEEIKKIQAMADWNIKHYGLQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagctgcacctaaaacatatcttgcctccgggcacagcggctgtgcaggatgc
tgtgacgcctttgccgcaaagttcacactcatgggcgcaggcccaaactgtattgtggtt
aaccctacaggctgccttgaagtaatgaccactcctttcccgaattctgcctggcaggtt
ccatggatccactccctgtttgaaaacgcaggtgcagtggcttcaggtgtggaagctgcc
ctgatagcccttggcaaaaagaatgataccaaggtcatatcaataggtggcgacggctct
actatggacatagggatcaggtctctctcaggcgcctttgagcgcggccatgatttcacc
tatgtatgcatggacaatgaagcttacatgaatacagggattcagcgcagcagcggaact
cctttcgatgccagtacaacgacaagccctccaggaaaattctctttcggaaatccacgt
ccaaaaaaggatatggttgcaattatggcagcccatggctctccttatgttgcaacaacc
tcaatcggctacccgagagacatgattcgtaaagttaaaaaagccacagaaatagttggc
ccgacttatatccacgcccatgctccctgtactacaggctggggttttgatacgtctaag
accctggaagttgccaagcttgcagtggaaacctgtctctggcccatgtacgaaatggaa
aacggagaaatcacacaggtcagaaaggtcaaagacccgaagccagtcgaggattatctg
agagttcagaagcgcttcaagcacctcttcacaatggaaggcggtgaagaagaaatcaag
aaaatccaggctatggcagattggaacataaaacactacggacttcagtaa

DBGET integrated database retrieval system