KEGG   Methanosarcina mazei Go1: MM_1541Help
Entry
MM_1541           CDS       T00082                                 

Definition
(GenBank) Tetrahydromethanopterin S-methyltransferase, subunit G
  KO
K00583  tetrahydromethanopterin S-methyltransferase subunit G [EC:2.1.1.86]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00680  Methane metabolism
mma01100  Metabolic pathways
mma01120  Microbial metabolism in diverse environments
mma01200  Carbon metabolism
Module
mma_M00357  Methanogenesis, acetate => methane
mma_M00567  Methanogenesis, CO2 => methane
mma_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mma00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MM_1541
Enzymes [BR:mma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MM_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrG TIM
Motif
Other DBs
NCBI-ProteinID: AAM31237
UniProt: P80656
Position
complement(1841006..1841224)
Genome map
AA seq 72 aa AA seqDB search
MDGKAPAAFVEPGEFNEVMKRLDQIDEKVEFVNSEVAQRIGKKVGRDIGILYGGVIGLLL
FLIYVQISSMFM
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atggatggaaaagcaccagcagcgtttgtagagccaggcgagtttaatgaagtaatgaaa
aggctcgatcagattgatgaaaaggtagagttcgtcaacagtgaagttgcacagagaata
ggaaagaaggtaggaagagatatcggaattctgtacggcggagtaatcggcctgctgctc
ttcctgatctatgtccagatatcatcaatgttcatgtaa

DBGET integrated database retrieval system