KEGG   Methanosarcina mazei Go1: MM_1800
Entry
MM_1800           CDS       T00082                                 

Name
(GenBank) Transporter
  KO
K09125  queuosine precursor transporter
Organism
mma  Methanosarcina mazei Go1
Brite
KEGG Orthology (KO) [BR:mma00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mma02000]
    MM_1800
Transporters [BR:mma02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   MM_1800
SSDB
Motif
Pfam: Vut_1
Other DBs
NCBI-ProteinID: AAM31496
UniProt: Q8PW04
Position
2149409..2150098
AA seq 229 aa
MLTIFISSLLLGNLLGGKLVEIFGIVTSVGLFGYPPTFLITDIVEEVKGREVTKIFVHAG
FLSLCIALFFIFVSTGLPPSPLYPHNEAYNHVFSGSLRIILASMIAFLISQYHDIWAFNF
WKKKTNGRCLWLRNNLSTIVSQLLDSTVFMFIAFYHAGPEMGAAAIFSMILPLWILKVIF
ALLDTPFVYLGVKWLASGEEKENLHPDEGRETGIVKGQETPGSLNRSGL
NT seq 690 nt   +upstreamnt  +downstreamnt
ttgctgacaattttcatcagttctctgctcctcggaaacctcctggggggcaagctggtc
gagatctttggaatcgtaacctctgtcggccttttcggatacccgcctacctttcttatt
acggatatcgtagaagaggtaaaaggaagagaagtgacaaaaattttcgtgcatgcaggt
tttctttcactttgcatagccctatttttcatatttgttagcacaggccttcccccttcc
cctctatatcctcataatgaagcttataatcacgttttttcaggttccctgagaattatc
ctggcaagcatgatagcttttctcataagccagtaccacgacatctgggcttttaatttc
tggaagaaaaaaacaaatgggagatgcctgtggctcaggaataatctttcaacaattgtt
tcccagcttctcgactctaccgtttttatgtttatcgctttctatcatgcaggtcctgag
atgggcgcagctgctatattctccatgattttgccgctctggattcttaaggtgatcttt
gcccttcttgatactccatttgtataccttggagtaaaatggctcgcttccggagaggaa
aaagagaacctgcatcctgatgagggcagagagacaggaatagttaaaggtcaggagacc
cccggctccttaaaccgatcaggattgtag

DBGET integrated database retrieval system