KEGG   Methanosarcina mazei Go1: MM_1828Help
Entry
MM_1828           CDS       T00082                                 

Definition
(GenBank) Pyruvate carboxylase, subunit A
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00020  Citrate cycle (TCA cycle)
mma00620  Pyruvate metabolism
mma00720  Carbon fixation pathways in prokaryotes
mma01100  Metabolic pathways
mma01120  Microbial metabolism in diverse environments
mma01200  Carbon metabolism
mma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MM_1828
   00620 Pyruvate metabolism
    MM_1828
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MM_1828
Enzymes [BR:mma01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     MM_1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C RimK ATP-grasp ATP-grasp_3 GARS_A ATP-grasp_5 ATPgrasp_Ter Oxidored_nitro ATP-grasp_4 PK_C OAD_gamma Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AAM31524
UniProt: Q8PVX7
Position
2179038..2180531
Genome map
AA seq 497 aa AA seqDB search
MEGIMFKKVLVANRGEIAIRVMRACRELGISTVAVCSEADKSALFAKYADEAYLIGPAPS
SQSYLNMEAIIEVAKNTGAEAIHPGYGFLSENPAFAKRCEEEGIIFIGPPSNVIAEMGSK
IRARHLMMKAGVPVVPGTKDAVEDPEEAMEIAEKIGYPVLIKASAGGGGIGMKVVHSREE
LATSLSSTRQMAGSAFGDSSVFIEKYVEEPRHIEIQILADSHGNMVYLSDRECSIQRRHQ
KLIEEAPSPIMTPELRKQMGEAAVKVAKAIGYVNAGTVEFLYSKGNFYFLEVNTRLQVEH
GITEMVTGIDIVREQIRIAWGDKLDFEQEDIVIDGHAIECRINAEDPLNDFAPSPGKIRR
YRSAGGPGVRVDSGVHTGYTISPYYDSMISKLCVWSRKREEAIARMDRALYEYVVVGVKT
NIPFHKAVMRNPAFRRGDMTTSFIEEENILEAVEHVVKADSEKGATLASALEAKDKKVAA
ITAAVHAYVNMAQKTQR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtggaaggtatcatgttcaaaaaagtactcgttgcaaaccgcggtgaaatagcaatcagg
gttatgcgtgcctgcagggagctcgggatttcaacagttgctgtctgttccgaggctgac
aaaagcgccctttttgccaagtatgctgatgaagcctatctgatagggcctgccccttca
agccagagctacctgaatatggaagctatcattgaggttgcaaaaaacaccggagctgag
gcaatccaccccggctacggttttctttccgaaaaccctgcttttgcaaagcgctgtgag
gaagaaggcattattttcataggccctccaagcaatgtaattgccgaaatgggaagcaaa
atcagagcaaggcacctcatgatgaaagccggagtccctgtagttcccggaacaaaggac
gcagttgaggaccctgaagaagccatggaaattgcagaaaagatcggctatcctgtcctt
atcaaagcgtctgccggaggcggtggaatagggatgaaggttgtccactccagggaagag
cttgccacatccttaagctctacaaggcagatggcaggttccgctttcggggattcttcc
gtatttatcgaaaagtacgtggaagagccaaggcatatagagatccagatccttgctgac
tctcatggtaatatggtctacctctcagacagggaatgctcaatccagagaaggcaccag
aagctgattgaagaagctccttcccctataatgactccggaactcaggaagcagatgggg
gaggctgccgtaaaggttgcaaaagcaattggttatgtaaacgcagggaccgtcgagttc
ctttactctaaagggaatttctatttccttgaagtcaatactcgccttcaggtggaacat
ggaattaccgaaatggtaaccggaattgatattgtcagggaacagatcaggatcgcctgg
ggagacaaactcgattttgaacaggaagatatagttattgacgggcatgcaatcgaatgc
agaataaatgccgaagatcccctgaatgattttgctccttcccctggaaagatccggagg
taccgttctgcaggagggcccggagtaagggtggacagcggagttcatacaggctataca
atctctccttattatgactccatgatttccaagctctgtgtctggtccagaaaaagagaa
gaggctatcgccaggatggacagggcactctacgagtatgtggtcgttggagtaaaaacc
aatatccctttccataaagctgttatgaggaaccctgcattccgcagaggcgacatgaca
accagctttatcgaagaggagaatatccttgaggctgtggaacacgtcgttaaggctgac
agtgagaaaggtgctactctggcttcggcccttgaggctaaggacaagaaagttgcagca
atcacggccgctgtacatgcctatgttaacatggcccagaaaacacagcggtga

DBGET integrated database retrieval system