KEGG   Methanosarcina mazei Go1: MM_2782Help
Entry
MM_2782           CDS       T00082                                 

Definition
(GenBank) Glyceraldehyde 3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00010  Glycolysis / Gluconeogenesis
mma01100  Metabolic pathways
mma01110  Biosynthesis of secondary metabolites
mma01120  Microbial metabolism in diverse environments
mma01130  Biosynthesis of antibiotics
mma01200  Carbon metabolism
mma01230  Biosynthesis of amino acids
Module
mma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mma_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MM_2782
Enzymes [BR:mma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     MM_2782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N Sacchrp_dh_NADP 2-Hacid_dh_C Semialdhyde_dh NAD_binding_3 GFO_IDH_MocA TrkA_N
Motif
Other DBs
NCBI-ProteinID: AAM32478
UniProt: Q8PTD3
Position
3335707..3336714
Genome map
AA seq 335 aa AA seqDB search
MVKAKIAVNGYGTIGKRVADAVQAQDDMEIIGVSKTKPNYEAAVAHQKGYDLFAPASNSG
AFEKAGIPLAGTIEEMVEKADLVVDCTPGGIGEANKPMYEKAGVKAIWQGGEDHELAGFS
FNAASNYEGALGRDLVRVVSCNTTGLCRVIYPIDRELGVKKVRVTLARRATDPNDIKKGP
INAIVPDPIKLPSHHGPDIKSVLPHINITTAALKIPTTLMHLHTVNMEVNTDCTAEDINR
IFSSQSRIRFMSQGINSTAEIIELARDMGRPRNDMWENCIWPESITVHEREFYFFQAIHQ
ESIVVPETVDAIRAMMELESDGAKSIQKTNKAIGL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagcaaagattgcagtaaacggttacggaactatagggaaaagagttgcagac
gcagtacaggctcaggatgacatggagatcataggggtttcaaaaaccaagcccaattat
gaagctgcagtagcacaccagaaagggtatgatctatttgccccggcttcaaactccgga
gcctttgagaaagcaggtattccactcgccggaaccattgaagaaatggtagaaaaagca
gatctggtagttgactgtactcctgggggaattggggaagcaaataaaccaatgtatgaa
aaagccggagtaaaagcaatctggcagggcggtgaagatcatgaacttgcaggtttttcc
tttaatgctgcaagcaactacgaaggagctctcgggcgtgacctggtgagggtagtttcc
tgtaacacaacagggctttgcagggtcatttaccctattgacagggaactgggggtaaaa
aaggtaagggttacccttgcaagaagggctacggatcccaatgatataaagaaaggtcct
attaatgcaatcgtgcctgatccgataaaacttccgtcccaccacgggcctgacataaag
agtgtactccctcacatcaacattacaactgcagccctgaaaattccgacaacacttatg
cacctgcataccgtaaatatggaagtcaacaccgactgcactgctgaggatattaacagg
attttcagctctcagtcaagaatccgtttcatgagtcagggaattaattctactgctgag
attatcgaattagcaagagacatggggcgccccagaaacgacatgtgggagaactgcatc
tggcctgaatccattaccgtgcacgaaagggaattctatttcttccaggcaatccatcag
gaatcaattgtggtcccggaaactgtggatgctatccgtgcaatgatggagcttgagagc
gacggcgcaaaatcaatccagaaaacaaacaaagctatcgggctctga

DBGET integrated database retrieval system