KEGG   Methanosarcina mazei Go1: MM_2823Help
Entry
MM_2823           CDS       T00082                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mma01100  Metabolic pathways
mma01110  Biosynthesis of secondary metabolites
mma01130  Biosynthesis of antibiotics
mma01230  Biosynthesis of amino acids
Module
mma_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MM_2823
Enzymes [BR:mma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MM_2823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE ThiG FMN_dh His_biosynth QRPTase_C DHO_dh IMPDH
Motif
Other DBs
NCBI-ProteinID: AAM32519
UniProt: Q8PT94
Position
complement(3386809..3387612)
Genome map
AA seq 267 aa AA seqDB search
MHDSILHILNTTKTRIQTFGPDAYKKRSQPQFRKRDFIAAVAAAQAEGRVPVIAEVKPAS
PGKSFREVPPSVAADLALEMEEAGAVAISVLTEPGVFRGSLENLKEVRKTVCLPVLRKDF
IIDRVQLEEEGSDLVLLIAGILGKELGAFVELAIEKGFEPLVEVHSREELELALETDTKI
IGVNNRNFETLKIDLATTEELAPLIREYDLEHGTSHLIISESGMNSPSDVRRLMLAGADA
VLIGSALMESDSVFDKTKEFVQGFCWR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcacgattcaattctccatatccttaacacaacaaagacccgaatccaaacttttggg
cctgatgcttacaaaaagagatcgcagccgcagttccggaaaagagactttattgccgct
gtggcagccgcacaggcagaaggcagggttcctgtaattgcagaggtcaagcctgcgtcc
cctggaaagagtttcagggaagttccgccgtccgtggctgctgatcttgcactggaaatg
gaggaagcaggtgctgttgcaatctctgtccttacagagccgggagtgtttcggggttcg
ctagaaaacctgaaagaagtaaggaaaactgtgtgcctgcctgtactcaggaaggacttc
attattgatagagtgcagcttgaagaagagggaagcgatctcgtgctcctgatagcagga
atccttggaaaagagcttggagcatttgtcgagcttgccattgaaaaaggatttgagccc
cttgtagaggtgcacagcagggaagagcttgaacttgccctggaaacggatacaaaaata
ataggggtcaacaaccggaatttcgagacccttaaaatcgacctggctaccacggaagag
cttgcacccctcatccgggaatacgaccttgaacacgggaccagccatcttatcataagc
gagagcgggatgaacagtccctcagatgtcaggcgattgatgctggcaggggcagacgct
gtgcttatagggtctgcacttatggaaagtgactcggttttcgacaaaactaaagaattc
gtccagggcttttgctggcgttaa

DBGET integrated database retrieval system