KEGG   Methanosarcina mazei Go1: MM_3230Help
Entry
MM_3230           CDS       T00082                                 

Definition
(GenBank) Phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mma  Methanosarcina mazei Go1
Brite
KEGG Orthology (KO) [BR:mma00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MM_3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AAM32926
UniProt: Q8PS54
Position
3927396..3928421
Genome map
AA seq 341 aa AA seqDB search
MDLLVIAIILAGLYMAWNIGANDLANAMGTSVGTGALTIKQVIIIAAVFEFLGAVVFGNR
VTSTIAKGIVPIDMISSIHPDIVVLGMLASILAASFWVTLATFYNLPVSTSHSIVGSVLG
FGLIAAYNGIISFSDIHWTVLLKIIASWFISPALGAILAFLIFSIIRSLYLHRASDMPAV
EKKFLFLQIITGCYIAFAHGSNDVANAVGPLSAALNVLGVTGTGAPIWVLVMGGLGMVIG
MATWGYKVVETIGSKITELTPTRGFSAQFATASVVLLHSYSSLPISTTHTLVGSVIGVGL
AGGLAAVDLGVIWRIISSWIATVPIAALTSAIIFVGLEVIF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggatttacttgtcatagcaattatacttgcaggcttatacatggcctggaacataggg
gcaaacgacctcgcaaatgctatggggacttcagtcggaacgggtgccctgacaataaag
caggtcattattattgccgctgtgtttgagttcctgggtgccgtggtcttcggaaaccgg
gttacctcaacaattgcaaaggggattgttcctattgatatgatcagcagcattcatccg
gatatcgtggttctggggatgctggcctcgattcttgccgcaagtttctgggtaactcta
gcaactttttataacctccccgtctcaaccagccattccattgtcggttctgtgctcggt
ttcgggctgattgcagcctataacggaattatctctttttctgatattcactggactgtc
cttctgaaaatcattgccagctggtttatatctccggctcttggtgcgattcttgcgttt
ctgatattctctataataaggagcctttacctccacagggcttcggatatgcctgcagtt
gagaaaaaattcttattcttacagatcataactggctgttatatcgcatttgcgcacggg
tcaaacgatgtagcaaacgctgtaggtcctctctctgccgcacttaacgtactgggagta
acaggaaccggagccccaatatgggtacttgtaatgggcggcctcggcatggtaataggc
atggcaacctggggctataaagtggttgagaccatagggtcaaaaatcacggaactcacc
ccaacacgcggcttttccgcacagtttgcaactgcatcggttgttctgcttcacagttac
agttctctccctatttcgaccactcacactcttgtaggttcggtaattggcgtgggactt
gcaggagggcttgcagccgttgaccttggcgtgatatggaggattatttcttcctggata
gcaacagtccccatagctgcccttacatcggcaataatttttgtggggctcgaggtgata
ttttga

DBGET integrated database retrieval system