KEGG   Mycobacterium marinum E11: MMARE11_04610Help
Entry
MMARE11_04610     CDS       T04774                                 

Gene name
fadA2
Definition
(GenBank) acetyl-CoA acyltransferase FadA2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00071  Fatty acid degradation
mmae00072  Synthesis and degradation of ketone bodies
mmae00280  Valine, leucine and isoleucine degradation
mmae00310  Lysine degradation
mmae00362  Benzoate degradation
mmae00380  Tryptophan metabolism
mmae00620  Pyruvate metabolism
mmae00630  Glyoxylate and dicarboxylate metabolism
mmae00640  Propanoate metabolism
mmae00650  Butanoate metabolism
mmae00900  Terpenoid backbone biosynthesis
mmae01100  Metabolic pathways
mmae01110  Biosynthesis of secondary metabolites
mmae01120  Microbial metabolism in diverse environments
mmae01130  Biosynthesis of antibiotics
mmae01200  Carbon metabolism
mmae01212  Fatty acid metabolism
mmae02020  Two-component system
Module
mmae_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MMARE11_04610 (fadA2)
   00630 Glyoxylate and dicarboxylate metabolism
    MMARE11_04610 (fadA2)
   00640 Propanoate metabolism
    MMARE11_04610 (fadA2)
   00650 Butanoate metabolism
    MMARE11_04610 (fadA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MMARE11_04610 (fadA2)
   00072 Synthesis and degradation of ketone bodies
    MMARE11_04610 (fadA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MMARE11_04610 (fadA2)
   00310 Lysine degradation
    MMARE11_04610 (fadA2)
   00380 Tryptophan metabolism
    MMARE11_04610 (fadA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MMARE11_04610 (fadA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MMARE11_04610 (fadA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MMARE11_04610 (fadA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmae04147]
    MMARE11_04610 (fadA2)
Enzymes [BR:mmae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MMARE11_04610 (fadA2)
Exosome [BR:mmae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MMARE11_04610 (fadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDM74609
Position
547168..548493
Genome map
AA seq 441 aa AA seqDB search
MAPAAEKNAQTKRRVAVLGGNRIPFARSDGAYAEASNQDMFTAALAGLVDRFDLRGQRLG
AVVGGAVLKHSRDFNLMRECVLGSELSPYTAACDLQQACGTGLQAAIAAADGIAAGRYEV
AAAGGVDTTSDPPIGLGEDLRRTLLRLRRAKSNVHRLRLVGGLPANLGVEIPANSEPRTG
LSMGDHAAITAKQMGIKRVDQDELAAASHRNMADAYDRGFFDDLVTPFLGLYRDDNLRPN
SSVEKLASLRPVFGVKAGDATMTAGNSTPLTDGASVALLSSEQWAQEHSLSPLAYLVDAE
TAAVDYVNGNDGLLMAPTYAVPRLLARNGLTLQDFDFYEIHEAFASVVLAHLQAWESEEY
CKQRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRILAQTAKQLAEKKAERKGSAQP
VRALISICAAGGQGVAAILEA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtggcccctgctgctgagaagaatgcccagaccaagcggcgagtcgccgtcctggggggt
aatcgaatccccttcgcccggtccgacggcgcttacgccgaagcgtccaaccaggacatg
ttcaccgcggcgctggccgggctggtggaccggttcgacctgcgcgggcaacggctgggc
gccgtcgtcggtggtgccgtgctcaagcacagccgcgacttcaacctgatgcgcgaatgc
gtgttgggatcagagctgtccccgtacaccgcggcgtgtgacctgcagcaagcctgcggg
accggcctgcaggccgcgatcgctgccgctgacgggatcgccgccggacgttatgaggtt
gcggcggccggcggcgtggacaccacctcggacccgccgatcgggctgggtgaggacctg
cgccgcactctgctgcggctgcgtcgggccaagtccaacgtgcacaggctgcgcctggtg
ggtgggctgccggccaatctgggagtcgagatcccggccaacagcgagccccggaccggg
ctgtcgatgggcgatcacgccgccatcaccgccaagcagatgggtatcaaacgcgttgac
caggacgaactggccgcggccagtcatcgcaacatggccgacgcctacgaccgcggattc
ttcgacgacctggtgacgccatttttggggctgtaccgcgacgacaacctgcgccccaac
tcgagcgtcgagaagctcgcctcgctgcgcccggtattcggcgtcaaggccggcgacgcc
accatgacggcgggcaactcgactccgctgaccgacggtgcctcggttgcgttgctgtcc
agcgagcaatgggcgcaggagcattcgttgtcgccgctggcctacctcgtggacgccgag
acggccgcggtggactacgtcaacggcaacgacggtctgttgatggcgcccacctacgcc
gtgccgcgactgctggcccgcaacgggttgacgctgcaagacttcgacttctacgagatc
cacgaggccttcgcctcggtggtgttggcgcacctgcaggcgtgggagtccgaggagtac
tgcaagcagcgcctgggactggacgccgcgcttggttcgatcgaccggtccaagctcaac
gtcaacggttcatcgttggccgccgggcaccccttcgcggcaaccggcggacggatactg
gcgcagaccgccaagcagctggccgagaagaaggccgagcgcaagggatcggcccagccc
gtgcgcgcgctgatctcgatctgcgctgccggcggtcagggcgtggccgcaatcctggag
gcctga

DBGET integrated database retrieval system