KEGG   Mycobacterium marinum E11: MMARE11_05400
Entry
MMARE11_05400     CDS       T04774                                 

Definition
(GenBank) epimerase
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00525  Acarbose and validamycin biosynthesis
mmae01100  Metabolic pathways
mmae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    MMARE11_05400
Enzymes [BR:mmae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     MMARE11_05400
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: CDM74688
Position
637556..638341
AA seq 261 aa
MNRIAVAAPQWRIADCRAAAAAMAIRSGADELQIDFGGAHRGPRLDVPAEQAVVARIARS
IPVTALAVNHANDLGLIDEHGQPNAEAAALLRVALRCAVELGIGVLHIPGFRRSTPDSPQ
RVAGTAAVLRSICQRAERHGITVAYESALSGAASAALVEAVGHRHLRVVLDIGNLLDFGH
RPGEFVSAVGELLHPDLHVKDPAASRVDVVSELRDVLSSPAPVRSLLVENDYRAIPGRLA
ADVAVCRGLIRSHATRMRSRC
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaaccgcatcgcggtggccgcaccccagtggcgcatcgccgattgccgtgcggccgct
gcggccatggcaatccgcagtggcgccgatgaactgcagatcgacttcggtggtgcccat
cgcggcccgcgcctcgatgtgcccgcggagcaggccgtcgtcgcgcggatcgctcgcagc
atccccgtcaccgcgctggcggtcaatcacgccaacgatctcggcctcatcgacgagcac
gggcagcccaacgcggaggccgcggcgctgctgcgcgtggcgctgcggtgtgcggtcgag
ctgggcatcggcgttctgcacattcccggatttcgccgcagcaccccggattccccgcaa
cgggtggccggaaccgcggcagtcctgcgctcgatatgccagcgcgccgaacgccacggc
atcaccgtcgcctacgaatccgcgctcagcggagccgccagcgccgccctggtcgaggcg
gtcggtcatcgccacctgcgtgtcgtgctcgatatcgggaacctgctcgactttgggcac
cggcccggcgaattcgtcagcgcggtaggcgagttgctgcacccggacctgcatgtcaaa
gacccggcggccagccgcgttgatgtggtcagcgaactacgcgatgtgctgtcttcgccc
gcaccggtgcggtccttgctggtcgaaaacgactaccgcgccatacccggccggctggcc
gccgatgtcgccgtctgccgcggcctgatccgctcgcacgcgactcggatgcgtagccgc
tgctga

DBGET integrated database retrieval system