KEGG   Mycobacterium marinum E11: MMARE11_14060Help
Entry
MMARE11_14060     CDS       T04774                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00360  Phenylalanine metabolism
mmae00362  Benzoate degradation
mmae00621  Dioxin degradation
mmae00622  Xylene degradation
mmae01100  Metabolic pathways
mmae01120  Microbial metabolism in diverse environments
mmae01220  Degradation of aromatic compounds
Module
mmae_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    MMARE11_14060
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MMARE11_14060
   00622 Xylene degradation
    MMARE11_14060
   00621 Dioxin degradation
    MMARE11_14060
Enzymes [BR:mmae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     MMARE11_14060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: CDM75554
Position
1686392..1687426
Genome map
AA seq 344 aa AA seqDB search
MIRDLYISDVTLRDGMHAVRHQYSIAQAVAIARALDDAGVDSIEVAHGDGLGGSSCCYGF
GAHTDLEWIEAVAGAVDRARVATLLLPGIGSVANLEDARRAGASVVRVGTHCTEADLAAR
YLGAARDLGMDAVGFLMMSHLTTPKRLAEQAKLLEGYGAPCVYVVDSGGALTGAAVAQRF
DALRQNLDPATELGIHAHHNLSLGVANSVVAVEHGARRIDASLAGMGAGAGNAPLEVLIA
VVNRLGWTHGCELNALEDAADDLVRPLQDRPVRIDRETLTLGYAGVYSSFLRHAEITAGR
YGVDARSLLEEAGRRGLIGGQEDLLVDIALDLVGPAEPLAHGAP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgatctgtacatcagcgacgtcaccttgcgcgacggcatgcacgcggtgcgt
caccagtacagcatcgcccaagccgtggcgattgccagggcgctcgacgatgcgggggtc
gactcgatcgaggtcgcccacggtgacggcctgggcgggtcgagctgttgttacggcttt
ggcgcgcacaccgacctggaatggatcgaagctgtcgccggcgctgtcgatcgcgccagg
gtggcgacattgctgctgcccgggattggcagcgtcgccaacctcgaggacgcgcgccgc
gccggcgcgagcgtggtgcgggtgggtacccactgcaccgaagccgatctggccgctcgc
tacctcggggccgcccgtgacctcggtatggacgcggtcggattcttgatgatgagccac
ctgaccaccccgaaacggttggccgaacaggccaaactgctggagggctacggggcgccc
tgcgtgtacgtcgtcgactccggaggtgcgctgaccggtgccgccgttgcgcagcgattt
gacgcgctgcgccagaatctggatccggcaacggaattgggaatccatgcgcaccacaat
ctgtcgctgggcgtggcgaactcggtggtggccgtcgagcatggtgcgcgccgcatcgac
gcctcgctggcgggcatgggtgccggggcgggaaacgcgcccctggaagtgctcatcgcc
gtggtgaaccggctgggctggacgcacggatgcgagctgaacgccctggaagacgccgcc
gacgacctggtccggccgctgcaggatcggccggtgcgcatcgaccgcgagacgctgacg
ctgggctacgccggggtgtattcgagcttcctgcggcacgccgaaatcaccgccgggcgt
tacggggtggacgcgcgcagtctgctcgaggaggccggtcgccgcggcctgatcggcggc
caagaggacttgctcgtcgatatcgctctggatctggtcgggccggccgagccgttggcc
cacggtgcgccatga

DBGET integrated database retrieval system