KEGG   Mycobacterium marinum E11: MMARE11_17480Help
Entry
MMARE11_17480     CDS       T04774                                 

Gene name
amiC
Definition
(GenBank) amidase AmiC
  KO
K01426  amidase [EC:3.5.1.4]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00330  Arginine and proline metabolism
mmae00360  Phenylalanine metabolism
mmae00380  Tryptophan metabolism
mmae00627  Aminobenzoate degradation
mmae00643  Styrene degradation
mmae01100  Metabolic pathways
mmae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    MMARE11_17480 (amiC)
   00360 Phenylalanine metabolism
    MMARE11_17480 (amiC)
   00380 Tryptophan metabolism
    MMARE11_17480 (amiC)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MMARE11_17480 (amiC)
   00643 Styrene degradation
    MMARE11_17480 (amiC)
Enzymes [BR:mmae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     MMARE11_17480 (amiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CDM75896
Position
2102796..2104214
Genome map
AA seq 472 aa AA seqDB search
MVRVHAFGDDVLGDLDAVGLADAIRSGQLGAVEVVEAAVARTEAVNARLNGVAHADFDRA
RDAAQQHGRGSGRGFFGGVPSYIKDNVDVSGLPTMRGTDAWVPRRAGTDSEIARELLSTG
LIALGKTQMSEFGFCAAAEHPRLGPVRNPWNTDHTAGASSSGSGALVAAGVVPIAHANDG
GGSIRIPASCNGLVGLKPSRGRLPLNSQLRRLPLVIVANGVLTRSVRDTAAIYREVERSW
RPSGLPPIGDVTRPGTERLKIAVVTRSVDGECGTEMRELTLKTAGLLEELGHRVEYVEQV
PVPESLPDDFILYWGFLATAQVLTGRYSFGKSFDRNRLDSLTLGLARHANRNVHRLPTAV
ARLRTLRRHTERFFQRYDVVLTPTLADPPPQVGYLSPTDYHQVIERLRKWVTFTPLQNVT
GDPAISLPLAQSSDGLPVGMMLTADIGREARLLELAYELEEAQPFARIHVPG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggtccgtgtccacgctttcggtgacgacgtcctcggtgaccttgacgctgtcggccta
gccgatgccatccggtccggccagttgggtgcggtcgaggttgtcgaggccgccgtcgcg
cggaccgaagcggtcaacgcccggctcaacggcgtggcgcacgccgattttgaccgggcg
cgagacgcggctcagcagcacgggcgcgggtcggggcgcggcttcttcggcggggtgccg
agttatatcaaggacaacgtcgacgtcagtggcctgccgacgatgcggggcactgacgcg
tgggtgccccgtcgggccggcaccgacagcgagattgcccgagaactgctgtctaccgga
ttgatcgcgttgggtaagacgcagatgtcggagttcggcttctgcgccgcggccgagcat
ccccggttgggcccggtccgtaatccgtggaataccgaccacaccgcgggcgcctcttcg
tcgggatcgggggcgttggtggccgcgggcgtggtgccgatcgcgcatgccaacgacggc
gggggttcgatccgaattccggcatcctgtaacggcctcgtcgggctcaagccgtcgcgc
ggtcggctgccattgaattcgcaattgcgccgactgccactggtcatcgtcgccaatggt
gtgctgacccggtcggtgcgtgacaccgctgccatctaccgcgaggtcgagcgcagctgg
cggccgagtggattgccacccatcggggacgtcacccggcccggcaccgagcggctcaag
atcgcggtggtgactcgctcggtcgacggtgaatgcggcaccgagatgcgggaactgaca
ttgaagaccgccgggcttctcgaggaacttgggcaccgggtcgaatatgtcgaacaggtt
ccggtaccggagtccttgcccgacgacttcatcttgtactggggcttcttggccaccgcg
caggtgcttaccggccgctattctttcggtaagtcgttcgatcgcaaccggttggacagt
ttgacactcgggttggctcgccacgccaaccgcaatgtgcaccgcttacccacggcggtg
gcccggttgcgtacgctgcggcggcacacagagcggttcttccaacgctatgacgtggta
ctcacgcctaccctcgcggacccgccgccgcaggtcggctacctttcgcccactgactac
caccaggtcatcgagcggctgcgcaagtgggtcacctttaccccgttgcagaacgtcacc
ggtgacccggcgatttcgctaccgctggcccaatcctcggatgggttgccggtgggcatg
atgctcacggctgacatcggccgcgaagcccgcctgctcgagctggcctacgaattggag
gaagcgcagcctttcgcgcgcatccacgtacccgggtga

DBGET integrated database retrieval system