KEGG   Mycobacterium marinum E11: MMARE11_26340Help
Entry
MMARE11_26340     CDS       T04774                                 

Gene name
glcB
Definition
(GenBank) malate synthase G GlcB
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00620  Pyruvate metabolism
mmae00630  Glyoxylate and dicarboxylate metabolism
mmae01100  Metabolic pathways
mmae01110  Biosynthesis of secondary metabolites
mmae01120  Microbial metabolism in diverse environments
mmae01200  Carbon metabolism
Module
mmae_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MMARE11_26340 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    MMARE11_26340 (glcB)
Enzymes [BR:mmae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MMARE11_26340 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: CDM76781
Structure
PDB: 

Position
complement(3174696..3176891)
Genome map
AA seq 731 aa AA seqDB search
MTDRVSAGNLRVARVLYDFVNNEALPGTDIDQDSFWAGVDKVVTDLTPQNQDLLKTRDDL
QAQIDKWHRHRVIEPLDPQAYREFLTEIGYLLPAPEDFTITTSGVDDEITTTAGPQLVVP
ILNARFALNAANARWGSLYDALYGTDVISESDGAEKGRGYNKVRGDKVIAYARQFLDDSV
PLAGASYTDATGFKVEDGQLVVSLADTSAALADPGQFAGYTGAAENPKSILLANHGLHIE
ILIDPESQIGATDGAGVKDVILESAITTIMDFEDSVAAVDADDKVLGYRNWLGLNRGDLS
EDVTKDDKTFTRVLNTDRTYTAPHGGELTLPGRSLLFVRNVGHLMTNDAIVSDAEGAEGA
PVFEGIMDALFTGLIAIHGLRSTDANGLLTNSRTGSIYIVKPKMHGPAEVAFTCELFSRV
EDVLGLPQGTMKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGP
MIRKGAMKNTAWIKAYEDANVDTGLAAGFSGKAQIGKGMWAMTELMADMVEQKIAQPKAG
ATTAWVPSPTAATLHAMHYHKVDVFAVQKELQGKTRTSVDELLTIPLAKELAWAPEEIRE
EVDNNCQSILGYVVRWIDQGVGCSKVPDIHNVALMEDRATLRISSQLLANWLRHGVITSE
DVRASLERMAPLVDKQNAGDPEYHAMAPNFDDSIAFLAAQDLILSGAQQPNGYTEPILHR
RRRELKARAGA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcgcgtgtcggcggggaatttgcgcgtcgctcgggtgctctacgacttcgta
aacaacgaggccctgcccggcaccgacatcgaccaggacagcttctgggcgggcgtggac
aaggtggtcaccgacctcaccccgcagaaccaggatttgctgaaaactcgcgatgatctg
caggcccagatcgacaagtggcatcgccaccgggtgatcgagccgttggacccgcaggcc
taccgcgagttcctcaccgagatcgggtacctgctgccggcacccgaggacttcaccatc
accacctccggggttgacgacgagatcaccacgaccgccggcccgcagctggtggtgccg
atcctcaacgcgcggttcgccctcaacgctgccaacgcccgctggggctcgctctacgac
gccttgtacggcaccgacgtcatctccgaaagcgacggcgccgaaaagggccggggctac
aacaaggtccgtggtgacaaggtaatcgcctacgcgcgccagttcctcgacgacagcgtg
ccgctggcgggggcgtcctacaccgatgccaccggcttcaaggtggaagacggacagctg
gtggtgtcgctggcggacacgtccgcagcgctggccgatcccggccagttcgccggctac
accggcgccgccgagaacccaaagtcgatcctgctggccaatcacgggctgcacatcgag
atcctgatcgaccccgagtcgcagatcggtgccaccgacggcgccggcgtcaaggacgtg
atcctggagtccgcgatcaccaccatcatggacttcgaggactcggtggccgcggtcgac
gctgacgacaaggtgctgggctatcggaactggctcggactgaaccggggcgatctgtcc
gaggacgtcaccaaggacgacaagaccttcacccgcgtgctcaacaccgaccgcacctac
accgccccgcacggtggtgagctgaccttgcccggccgcagcctgttgttcgttcgcaac
gtgggccatctgatgaccaacgacgccatcgtttcggacgctgaaggcgccgagggcgcc
ccggtgttcgagggcatcatggatgcgctgttcaccggcctgatcgccatccacggtctg
cgaagcaccgatgccaacgggctgctgaccaacagccgcacgggctccatctacatcgtc
aagcccaagatgcacggtcccgccgaggtggcgttcacctgtgaattgttcagccgcgtc
gaggacgtgctggggttgccgcaggggaccatgaaggtcggcatcatggacgaagagcga
cgtaccacgctcaacttgaaggcatgcatcaaggcggccgccgaccgggtggtgtttatc
aacaccggcttcctggaccgcaccggtgatgagatccacacctcgatggaagccggcccg
atgatccgcaagggcgcgatgaagaacacggcgtggatcaaggcctacgaggacgccaac
gtcgacaccgggctcgccgccggcttctccggtaaggcgcagatcggcaagggcatgtgg
gcgatgaccgaactgatggccgacatggtggagcagaagatcgcccagccgaaggccggc
gcgaccaccgcgtgggtgccatcacccaccgcggccaccctgcacgcgatgcactatcac
aaggtggatgtgtttgcggtgcagaaggagctgcagggcaagacccgcaccagcgttgac
gaattgctgaccattccgctggccaaggaactggcctgggcgcccgaggagatccgcgaa
gaggtcgacaacaactgccagtccatcctcggttacgtggtgcgctggatcgaccagggc
gtcggctgttcgaaggttcccgacatccacaacgtggccctcatggaggaccgcgccacc
ctgcggatttccagccagttgctggccaactggctacggcatggcgtgatcaccagcgag
gatgtgcgggctagcctcgagcgcatggcaccgctggtggacaagcagaacgccggagat
cccgaataccacgcgatggcacccaatttcgacgacagcatcgcattcctggcggcccag
gatctgatcttgtcgggggcacagcagcccaacggatacacggagccgatcctgcaccgt
cgtcgtcgtgaattgaaggcacgcgctggtgcctga

DBGET integrated database retrieval system