KEGG   Mycobacterium marinum E11: MMARE11_32060Help
Entry
MMARE11_32060     CDS       T04774                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00860  Porphyrin and chlorophyll metabolism
mmae01100  Metabolic pathways
mmae03030  DNA replication
Module
mmae_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MMARE11_32060
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MMARE11_32060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmae03032]
    MMARE11_32060
Enzymes [BR:mmae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     MMARE11_32060
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     MMARE11_32060
DNA replication proteins [BR:mmae03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     MMARE11_32060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: CDM77350
Position
complement(3910920..3912044)
Genome map
AA seq 374 aa AA seqDB search
MKVIIEADGGSRGNPGPAGYGAVVWTADRSTVLAESKQAIGRATNNVAEYRGLIAGLDDA
VKLGATEVSVLMDSKLVVEQMCGRWKVKHPDLVELHGQARELAGQFRRISYAWIPRARNA
HADRLANEAMDAAVRTNRRGEPGTVAVAAVADPANTAPVQTPAAPGWTGRRDTATRLLLL
RHGQTELSVQRRYSGRGNPALNEVGWRQAGLAARYIAQRGGIAAVVSSPLQRAYDTATTA
ARALGLDVTVDEDLVETDFGVWEGMTFAEAANRDPDLHHRWLNDTSITPPGGESFDEVLR
RVRRGRDRMISRYEGTTVLVVSHVTPIKMLLRLALDVGSEVLYRLHLDLASLSIAEFYAD
GASSVRLVNQTGYL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtcatcatcgaagctgatggtggatcgcgtggtaacccggggccggccggatac
ggcgcagtggtgtggaccgcggaccgctcgaccgtgttggcggagagcaaacaggcgatc
ggccgcgccaccaacaacgtcgctgaataccgcggtctgatagccggtttggacgacgcc
gtcaagctgggtgccaccgaagtgtcggtcctgatggattccaaactggtggtcgagcag
atgtgcgggcgctggaaggtcaagcacccggacctggtggaactgcatgggcaggcgcgc
gagctggcagggcaattccgccggatcagctacgcctggattccgcgggcccgcaatgcg
catgccgaccggctggccaacgaagcgatggacgccgcggttcgcaccaatcggcgtggc
gaacccggtaccgtggcggtggccgccgtcgccgaccccgccaacacggcgcctgtgcaa
accccggcagctcccggatggaccggtagacgcgatacggccaccaggctgctgctgctg
cgacatggtcagaccgaactgtcggtgcaacgccgctattccgggcgcggcaacccggcg
ctcaacgaagtcggttggcgccaagccggtttggccgcccgctacatcgcgcaacgcggc
ggaattgctgcggtggtgtcctcgcctctgcagcgtgcctacgatacggcgacgacggcg
gcccgagccctcgggctggacgtgacggtggacgaagacctggtcgaaacggacttcggg
gtctgggaaggcatgactttcgcggaggccgccaaccgcgaccccgacctgcaccatcgt
tggctcaacgacaccagcatcacgccgccgggcggtgagagcttcgatgaagtgctgcgg
cgggttcggcgcggacgcgaccggatgatctcccggtatgaaggcacgaccgtgctggtg
gtctcacacgtcacgcccatcaagatgttgctgcgactcgcgctcgatgtgggctccgag
gtcctctaccggctgcatcttgatctggcgtcgctgagcatcgccgagttctatgccgac
ggcgcgtcgtcggtgcggctggtcaaccagaccggctacctgtag

DBGET integrated database retrieval system