KEGG   Mycobacterium marinum E11: MMARE11_47380Help
Entry
MMARE11_47380     CDS       T04774                                 

Gene name
aldA
Definition
(GenBank) NAD-dependent aldehyde dehydrogenase, AldA
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00010  Glycolysis / Gluconeogenesis
mmae00053  Ascorbate and aldarate metabolism
mmae00071  Fatty acid degradation
mmae00280  Valine, leucine and isoleucine degradation
mmae00310  Lysine degradation
mmae00330  Arginine and proline metabolism
mmae00340  Histidine metabolism
mmae00380  Tryptophan metabolism
mmae00410  beta-Alanine metabolism
mmae00561  Glycerolipid metabolism
mmae00620  Pyruvate metabolism
mmae00625  Chloroalkane and chloroalkene degradation
mmae00903  Limonene and pinene degradation
mmae01100  Metabolic pathways
mmae01110  Biosynthesis of secondary metabolites
mmae01120  Microbial metabolism in diverse environments
mmae01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMARE11_47380 (aldA)
   00053 Ascorbate and aldarate metabolism
    MMARE11_47380 (aldA)
   00620 Pyruvate metabolism
    MMARE11_47380 (aldA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MMARE11_47380 (aldA)
   00561 Glycerolipid metabolism
    MMARE11_47380 (aldA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MMARE11_47380 (aldA)
   00310 Lysine degradation
    MMARE11_47380 (aldA)
   00330 Arginine and proline metabolism
    MMARE11_47380 (aldA)
   00340 Histidine metabolism
    MMARE11_47380 (aldA)
   00380 Tryptophan metabolism
    MMARE11_47380 (aldA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MMARE11_47380 (aldA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MMARE11_47380 (aldA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MMARE11_47380 (aldA)
Enzymes [BR:mmae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MMARE11_47380 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CDM78875
Position
complement(5681162..5682631)
Genome map
AA seq 489 aa AA seqDB search
MALLADGVSSLFIDGKRCEGGAGTFATVNPATEETLGVAADADAGDMDRAIEAARRAFDD
TDWSRNTELRVRCVRQLRDAMREHIEELRAVTISEVGAPRMLTAAAQLEGPVNDLAFSAD
TAESYSWKQDLGAAAPMGIPTRRTVVREAVGVVGAITPWNFPHQINLAKLGPALAAGNTV
VLKPAPDTPWCAAVLGELIADCTDIPPGVVNIVTSSEHGLGALLAKDPRVDMVSFTGSTA
TGRSVMADGAATIKRMFLELGGKSAFIVLDDADLAAASSVSAFTASMHAGQGCAITTRLV
VPRARYDEAVAIAAGTMSSIKPGDPDDARTVCGPLISQRQRDRVQGYLDLAIAEGGTFAC
GGGRPAGRQVGYFIEPTVIAGLTNDARPAREEIFGPVLTVLAHDGDDDAVRIANDSPYGL
SGTVYGGDPQRAADVAARLRVGTVNVNGGVWYCADAPFGGYKQSGIGREMGLAGFEEYLE
TKLIATAAN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggccctgttggccgacggagtcagctcactgttcatcgatggcaagcgctgcgagggt
ggggcgggtacttttgcgaccgtcaacccggccaccgaggaaacgctcggcgtggcggcc
gatgccgatgcgggtgatatggaccgggcgatcgaggccgcgcgccgcgcattcgacgac
accgattggtcgcgcaacaccgaattgcgggtgcgatgcgtgcggcagctgcgtgacgcg
atgcgtgaacacatcgaggagctgcgcgcggtgaccatctccgaagtcggggcgccgcgg
atgctcaccgccgccgctcaattggagggtccggtcaatgacctggccttttctgccgac
accgccgaatcctattcctggaagcaggatctcggtgcggcggcgcccatgggcatcccg
acgcggcgcaccgtcgttcgcgaggcggtgggcgtcgtcggcgccatcacgccgtggaac
ttcccgcaccagatcaacctcgccaagctgggccccgcgctggccgcgggcaataccgtc
gtgctgaaaccggcaccggacacaccgtggtgcgcggcggtgctcggcgaattgatcgcc
gattgcaccgatatcccacccggcgtcgtcaacatcgtcacctccagcgaacacggcctg
ggcgctctgttggccaaagaccctcgcgtggacatggtttcgttcaccggatccaccgcg
accggccgcagtgtgatggccgatggggcggccaccatcaagagaatgttcttggagctg
ggtggcaaatcggccttcatcgtgctcgatgacgccgacctggccgcggcgagctcggta
tcggccttcaccgcaagcatgcatgccgggcaggggtgtgcgatcaccaccaggctggtg
gtgccgcgtgcccgctacgacgaggccgtcgcaatagctgcggggaccatgtcgtcgatc
aagcccggcgatcctgatgatgccagaacggtttgtggtcctttgatttcgcaacggcag
cgggaccgggtacagggttatctcgacttggcgatcgccgaaggcggaaccttcgcttgc
ggcggcgggaggccggccggccggcaggtcggttacttcatcgagcccacggtgatcgcg
ggtctgaccaacgatgcccggcccgcgcgcgaagagatcttcggtccggtgctcacggtg
cttgctcacgacggtgacgatgacgccgtgcgcatcgccaacgattcaccgtatggcttg
tcgggcaccgtttatggcggtgacccgcagcgagccgccgacgtcgccgcgcggctgcgg
gtgggcaccgtgaacgtcaacggcggggtttggtattgcgctgatgcgccgttcggggga
tacaagcaatccgggatcgggcgtgagatgggcctcgccggattcgaggagtatctggaa
accaagctgattgcgactgcggcgaattag

DBGET integrated database retrieval system