KEGG   Methylocaldum marinum: sS8_0944Help
Entry
sS8_0944          CDS       T05638                                 

Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
mmai  Methylocaldum marinum
Brite
KEGG Orthology (KO) [BR:mmai00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    sS8_0944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: BBA32909
UniProt: A0A250KT02
Position
1030498..1030875
Genome map
AA seq 125 aa AA seqDB search
MNNKYRIAIDAVTDYLEAESSPESNRYVFAYTITIHNAGDIPAKLVSRHWIITDAHGKVQ
EVRGEGVVGEQPHLSPGESFRYTSAAMIETPVGTMHGEYQMVADDGQHFDAEIPSFTLAI
PRTLH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaatatcgtatcgctatcgacgcagtaaccgattatctggaagcggagtcg
tcaccggaatcgaaccgctacgtattcgcttataccatcactatccacaacgcgggcgac
ataccggccaaattggtgtcccgccactggatcatcaccgacgcgcacggaaaggtacag
gaagtccgcggcgaaggggtcgtaggcgaacagcctcatctttctccgggcgaatcgttc
cgctataccagtgccgctatgatcgaaacgccggtaggcacgatgcacggcgaataccag
atggttgccgacgacggacagcattttgatgccgaaataccgtcatttaccttggcgatt
ccacgcaccttgcactga

DBGET integrated database retrieval system