KEGG   Methylocaldum marinum: sS8_3474Help
Entry
sS8_3474          CDS       T05638                                 

Definition
(GenBank) piperidine-6-carboxylate dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mmai  Methylocaldum marinum
Pathway
mmai00010  Glycolysis / Gluconeogenesis
mmai00053  Ascorbate and aldarate metabolism
mmai00071  Fatty acid degradation
mmai00280  Valine, leucine and isoleucine degradation
mmai00310  Lysine degradation
mmai00330  Arginine and proline metabolism
mmai00340  Histidine metabolism
mmai00380  Tryptophan metabolism
mmai00410  beta-Alanine metabolism
mmai00561  Glycerolipid metabolism
mmai00620  Pyruvate metabolism
mmai00625  Chloroalkane and chloroalkene degradation
mmai01100  Metabolic pathways
mmai01110  Biosynthesis of secondary metabolites
mmai01120  Microbial metabolism in diverse environments
mmai01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sS8_3474
   00053 Ascorbate and aldarate metabolism
    sS8_3474
   00620 Pyruvate metabolism
    sS8_3474
  09103 Lipid metabolism
   00071 Fatty acid degradation
    sS8_3474
   00561 Glycerolipid metabolism
    sS8_3474
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    sS8_3474
   00310 Lysine degradation
    sS8_3474
   00330 Arginine and proline metabolism
    sS8_3474
   00340 Histidine metabolism
    sS8_3474
   00380 Tryptophan metabolism
    sS8_3474
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    sS8_3474
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    sS8_3474
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    sS8_3474
Enzymes [BR:mmai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     sS8_3474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh ETF
Motif
Other DBs
NCBI-ProteinID: BBA35411
UniProt: A0A250KWR8
Position
complement(3807209..3808774)
Genome map
AA seq 521 aa AA seqDB search
MHTHDNAFKSRLFETLHLLDLNIGSYAAYGGWLKAPDGPRLKSCNPATGETIAEVTLGSE
AQYETVLDEARKAFEEWRLVPAPERGAVVRRIGDALREHKDALGSLVALEMGKIKAEADG
EVQEMIDMADYAVGLSRMLYGNTMPSERPGHRLYEQWHPLGPVGVITGFNFPVAVWSWNA
FVAAVCGDTVVWKPSPKTPLCAVAVQHLCDRVVAELGYPGIFSSFLPENPELLDRFVRDP
RLPLISFTGSTAVGRQVAVKVAERLGRSLLELSGNNAVIVDETADPDLALRAILFGAVGT
AGQRCTSIRRLIIHESLYDNLIERLIRAYGEVRVGDPLDPSSLMGPLIDSAAVESYRSAV
EAARRQGGELLYGGRVLDRPGCFVEPTLIRADNRWDIVQRETFAPILYVMTFRRLEEAIA
LQNDAAQGLSSALFTLNLRAAERFLSASGSDCGIANINAGTSGAEIGGAFGGEKDTGGGR
EAGSDAWKMYMRRQTNTINWGETLPLAQGIAFFAANGGRDG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcatactcacgacaacgccttcaagtctcgactgttcgagactttgcatctcctggac
ctcaacatcggcagctatgccgcctatggggggtggctgaaagcccccgacggaccgcgg
ctgaaatcctgcaatcccgctaccggcgagacgatcgcggaggttacgctcggttcggaa
gctcagtacgaaaccgtgctggatgaggctcggaaagccttcgaggaatggcgccttgtc
ccggcgcccgagcgcggtgcggtggttcgccgcatcggcgacgccctgcgggaacacaag
gatgcgctgggcagcctggtggccctggaaatgggcaagatcaaggcggaagcggacggc
gaggtgcaggagatgatcgacatggccgactatgcggtcgggctgtcgcgcatgctgtac
ggcaatacgatgccttccgaacgccccgggcaccgcctttacgagcagtggcatcccctg
gggccggtcggcgtcatcaccggcttcaatttcccggtggcggtgtggtcgtggaacgcg
ttcgtcgcggcggtgtgcggcgatacggtcgtgtggaagccttccccgaagacgccgctc
tgcgccgtcgcggtccagcacctgtgcgatcgagtcgtggccgagctgggatatccgggc
attttttcctcctttttgccggaaaatccggaactgctcgaccgtttcgtccgcgacccg
cggctgcccctgatctcgttcaccggttccaccgccgtgggccgccaggtggcggtgaaa
gtcgccgagcgtttggggcggagtcttttggaactgtccggaaacaatgccgtcatcgtc
gacgaaaccgccgacccggatctcgcgctacgcgccattctgttcggtgccgtcggcact
gccggccagcgttgcaccagcatccggcggctgatcatccacgagagtctttacgacaat
ctgatcgagcgcctgatccgggcttacggcgaggtgcgggtcggcgatcccctggacccc
tcgagcctcatggggccgctcatcgattcggcggcggtcgagtcctaccgcagcgccgtc
gaggcggcacgccgccagggcggcgagctactctacggcggacgggtgctcgatcggccc
ggctgcttcgtcgagccgaccttgatccgggcggacaaccgctgggatatcgtgcagcgc
gaaaccttcgcgcccatcctctatgtgatgacgttccgccgcctggaagaggcgatcgcc
ctgcagaacgatgctgcgcaaggactgtcctcggcgctgttcaccctgaatctcagggcg
gcggagcggttcttgtcggcttccggcagcgactgcggcatcgccaacatcaatgccggc
acttccggcgcggaaatcggcggagccttcggcggcgagaaggatacggggggcggccgg
gaagcgggttccgacgcctggaagatgtacatgcgacggcagaccaataccatcaactgg
ggcgagacgctgccgctggcgcagggcatagcgtttttcgcagcgaatggcggacgggac
gggtag

DBGET integrated database retrieval system