KEGG   Mycobacterium marseillense: CKJ54_01710Help
Entry
CKJ54_01710       CDS       T05049                                 

Gene name
egtC
Definition
(GenBank) ergothioneine biosynthesis protein EgtC
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00340  Histidine metabolism
mmal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CKJ54_01710 (egtC)
Enzymes [BR:mmal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     CKJ54_01710 (egtC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4 Peptidase_M13_N
Motif
Other DBs
NCBI-ProteinID: ASW88750
UniProt: A0A1A3JY01
Position
345572..346285
Genome map
AA seq 237 aa AA seqDB search
MCRHLGWLGADVTVSSLVLDPPFGLRVQAYAPRRQKHCLLNADGWGVGFFDAASDGAPPR
RWRSQLPLWGDVSFESVAPALRSRCVVAAVRSATVGMPIETSATAPFTDGQWLLSHNGIV
DRAVLPATSQAESVCDSAMLAAVIFERGLDALGDTIAEIAAADPQARLNILAANGSRMLA
TAWGDTLSILRRPDGVVLASEPYDNDSDWEDVPDHHLVEVTENGVTMTPLDHPKGSR
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgccatctggggtggctcggggccgacgtcacggtctcctcgctggtgctcgat
cccccgttcgggctgcgggtgcaggcctacgcgccacgccgccaaaagcattgcctgttg
aacgcggacggttggggcgtcgggtttttcgatgccgcttcggatggcgccccgccccgg
cgctggcgtagccagctgccgctgtggggcgacgtgtcgttcgagtccgtcgcgccggcg
ctgcgcagccgctgcgtggtggccgcggtgcgctcggcgacggtcggcatgccgatcgaa
accagcgcgacggcgccgttcaccgacgggcagtggttgttgtcgcacaacggaattgtt
gaccgggccgtgctgccggcgacgtcgcaggccgaatcggtctgcgacagcgcgatgctg
gcggccgtcatcttcgagcgcggcctcgacgcgctcggcgacaccatcgccgagatcgct
gcggccgacccccaggctcggctgaacatactggccgccaacggttctcgcatgctggcg
acggcctggggggacacgctgtccatcctgcgccgcccggacggcgtggtcctggccagc
gaaccctatgacaacgactccgactgggaggacgtgccggaccaccacctcgtcgaagtc
accgaaaacggtgtcacgatgactccgctggatcatccgaaaggctctcgatga

DBGET integrated database retrieval system