KEGG   Mycobacterium marseillense: CKJ54_02455Help
Entry
CKJ54_02455       CDS       T05049                                 

Definition
(GenBank) arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00633  Nitrotoluene degradation
mmal00983  Drug metabolism - other enzymes
mmal01100  Metabolic pathways
mmal01110  Biosynthesis of secondary metabolites
mmal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    CKJ54_02455
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CKJ54_02455
   00983 Drug metabolism - other enzymes
    CKJ54_02455
Enzymes [BR:mmal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     CKJ54_02455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: ASW88882
Position
485025..485855
Genome map
AA seq 276 aa AA seqDB search
MALDLTGYFERVGYDGPTAPTRDVLQGLVTAHTGSIPFENLDPLMGVPVDDLSPEALTDK
LVYRRRGGYCYEQNGLMGYVLAEIGFRVRRLAGRVVWMLPPDAPPSAQTHTVLAVTFPGS
QGSYLVDVGFGGQTPTSPIRFETGNAQQTTHEPYRLNDRGEGLVLQALVRDEWKSLYVFG
TQTAPQVDLRVGSWYVSTHPESIFVTGLTAALTTDDARYNLAGRNLTIHRAEGSENIRLD
DAAAVVDVLAERFGIDVAGIGERSALEERIGQVLDA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcattggacctgaccggatacttcgagcgggtcggttacgacggccccaccgcaccg
acgcgcgacgttctgcaaggactcgtgaccgcgcacaccggatcgatcccgttcgagaac
ctcgatccgctgatgggggtgccggtcgacgacctgagtccggaggccctcaccgacaag
ctggtgtaccggcgacgtggtggctactgctacgagcagaacggtctgatgggttacgtg
ctggccgagatcgggttccgggtgcgccgcctggccgggcgggtggtctggatgttgccg
cccgacgcgccgcccagcgcccagacccacacggtgctggcggtgacgttcccgggctcg
cagggttcgtacctggtcgacgtcggcttcggcggccagacaccgacgtcccccatccgc
ttcgagaccggaaacgcccagcagaccacgcacgagccgtaccggctcaacgaccgcggc
gagggcctggtgctgcaagccctggtccgcgacgagtggaagtcgctgtacgtgttcggc
acccagaccgcgccgcaggtcgatctgagggtgggcagctggtacgtctccacgcacccc
gaatcgatcttcgtgaccgggctgacggccgcgctgacgaccgacgacgcccgctacaac
ctggccggtcgcaacctgaccatccaccgcgccgagggcagcgagaacatccggctggac
gacgcggcggcggtcgtcgatgtgctcgcagagcgattcggcatcgacgtggccggcatc
ggcgagcgcagcgcgctcgaggaacgcatcgggcaggtgctcgacgcctag

DBGET integrated database retrieval system