KEGG   Mycobacterium marseillense: CKJ54_02655Help
Entry
CKJ54_02655       CDS       T05049                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00071  Fatty acid degradation
mmal00072  Synthesis and degradation of ketone bodies
mmal00280  Valine, leucine and isoleucine degradation
mmal00310  Lysine degradation
mmal00362  Benzoate degradation
mmal00380  Tryptophan metabolism
mmal00620  Pyruvate metabolism
mmal00630  Glyoxylate and dicarboxylate metabolism
mmal00640  Propanoate metabolism
mmal00650  Butanoate metabolism
mmal00900  Terpenoid backbone biosynthesis
mmal01100  Metabolic pathways
mmal01110  Biosynthesis of secondary metabolites
mmal01120  Microbial metabolism in diverse environments
mmal01130  Biosynthesis of antibiotics
mmal01200  Carbon metabolism
mmal01212  Fatty acid metabolism
mmal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mmal00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CKJ54_02655
   00630 Glyoxylate and dicarboxylate metabolism
    CKJ54_02655
   00640 Propanoate metabolism
    CKJ54_02655
   00650 Butanoate metabolism
    CKJ54_02655
  Lipid metabolism
   00071 Fatty acid degradation
    CKJ54_02655
   00072 Synthesis and degradation of ketone bodies
    CKJ54_02655
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CKJ54_02655
   00310 Lysine degradation
    CKJ54_02655
   00380 Tryptophan metabolism
    CKJ54_02655
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CKJ54_02655
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CKJ54_02655
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CKJ54_02655
Enzymes [BR:mmal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CKJ54_02655
Exosome [BR:mmal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKJ54_02655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Peptidase_M22
Motif
Other DBs
NCBI-ProteinID: ASW88921
UniProt: A0A249B5I5
Position
complement(522270..523469)
Genome map
AA seq 399 aa AA seqDB search
MAGAGPNIAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGCTFDDIDAVVVGKAPD
FFEGVMMPELFMADAMGATGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLAMAWEKQ
SESNAMWALSIPIPFIKPVGAGAGGYFAPHVRSYIRRSGAPTNIGAIVAVKDRLNGARNP
LAHLHQPDITVEKVMSSPMLWDPIRYDETCPSSDGAAAVVIGNEEAAEARLAQGNPVAWI
HATALRTEPLQFSGRDQVSPQAGRDAAAALWKAAGITSPIDEIDAAEIYVPFSWFEPMWL
ENLGFAPEGEGWKLTEAGETKIGGRLPVNPSGGVLSSNPIGASGLIRFAEAAIQVMGKGG
DHQVPNARKALGHAYGGGSQYYSMWVVGADKPAAQKVDA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgcagggccgaacatcgccgcggtactaggtaccggacagacgaagtacgtc
gccaagcgccaggacgtttcgatgaacggcctggtgcgcgaggcgatcgatcgggcgctg
gccgactcgggttgcaccttcgacgacatcgacgccgtcgtggtcggcaaggccccggac
ttcttcgagggcgtcatgatgcccgagctgttcatggccgacgccatgggcgccaccggc
aagccgctgatccgggtgcacaccgcgggctcggtcggcggctccaccggcgtggtggcc
gccagtctggtgcagtcgggcaagtaccggcgcgtcctggcgatggcctgggagaagcag
tcggaatcaaacgcgatgtgggcgttgtcgattccgatccccttcatcaagccggtgggc
gccggcgcgggtggctacttcgccccgcacgtgcgctcctacatccgccggtccggggcg
ccgacgaacatcggcgccatcgtcgcggtcaaagaccggctcaacggcgcccgcaacccg
ctagcgcatctgcaccagcccgacatcaccgtggagaaggtgatgtcgtccccgatgctg
tgggacccgatccgctacgacgagacctgcccgtcctccgatggcgcggcggcggtggtg
atcggcaacgaagaggccgccgaagcgcgcctggcgcaaggcaatccggtggcctggatt
catgccacggcgctgcgcaccgaaccgctgcagttctccgggcgcgaccaggtcagcccg
caggccggccgcgacgcggccgccgcgctgtggaaggccgccggcatcacgagccccatc
gacgagatcgacgccgcggagatctacgtccctttctcctggttcgaaccgatgtggttg
gaaaacctcgggtttgcgcccgagggcgaaggctggaagctcaccgaggcgggcgagacc
aagatcggcggccggctgccggtgaacccgtcgggcggcgtgctgtcgtcgaacccgatc
ggcgcctcgggcctgatccgcttcgccgaagcggcgatccaggtcatgggcaagggcggc
gaccaccaagtgcccaacgcgcgaaaggcgttgggacacgcctacggcggcggctcgcag
tactactccatgtgggtggtcggcgccgacaaaccggcggcccaaaaagtcgacgcgtaa

DBGET integrated database retrieval system