KEGG   Mycobacterium marseillense: CKJ54_05520Help
Entry
CKJ54_05520       CDS       T05049                                 

Definition
(GenBank) steroid delta-isomerase
  KO
K16045  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00984  Steroid degradation
mmal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    CKJ54_05520
Enzymes [BR:mmal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     CKJ54_05520
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     CKJ54_05520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_10 GDP_Man_Dehyd RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 NmrA KR adh_short NAD_binding_2 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ASW89411
Position
complement(1101358..1102470)
Genome map
AA seq 370 aa AA seqDB search
MICPMGDASLTAELGRVLVTGGSGFVGANLVTTLLERGHQVRSFDRAPSPLPEHPALEVL
QGDITDTAVCAEAVDGIDTVFHTAAIIDLMGGASVTEEYRQRSFGVNVGGTENLIRAGQA
AGVQRFVYTSSNSVVMGGQNIASGDETLPYTGRFNDLYTETKVIAERFVLGQNGSPNGGA
GLLTCAIRPSGIWGRGDQTMFRKLFESVIAGHVKVLIGRKSARLDNSYVHNLIHGFILAA
QHLVPGGTAPGQAYFINDAEPINMFEFARPVIEACGENWPRVRVNGPVVRAAMTGWQRLH
FRFGIPAPLLEPLAVERLYLDNFFSIAKASRDLGYQPLFTTEQALSECLPYYVGMFDQMK
REALAGKASV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgatttgccccatgggtgatgcatcgctgacggccgaactcggccgcgtcctggtcacc
ggggggtccggattcgtcggcgccaacctggtgaccaccttgctcgagcgcgggcatcag
gtccgctcgtttgaccgcgccccctcgccgctgccggagcatcctgcgctcgaggtgctg
caaggagacatcaccgacacggccgtgtgcgccgaagcggtcgatggcatcgacacggtg
tttcacaccgcggcgatcatcgacctgatgggtggcgcgtcggtgaccgaggagtaccgg
cagcgcagcttcggggtcaacgtcgggggtaccgagaacctgatccgcgccgggcaggcg
gccggggtgcagcgcttcgtctacacctcgtcgaacagcgtcgtgatgggcggacagaac
atcgccagcggcgacgagaccttgccctacaccggccggttcaacgatctttacaccgag
accaaagtgatcgccgagcgatttgtattgggccagaacggctccccgaatggtggggcc
ggcctgctcacatgtgcgattcggcccagcggcatctggggccgcggtgaccagacgatg
ttccgcaagctgttcgaaagcgtgatcgccggtcacgtcaaggtgctgatcggtcgcaag
tcggcgcggttggacaactcctacgtgcacaacctgattcacggtttcatcctggcggcc
cagcatctggttcccggcggcaccgcgcccggccaggcgtacttcatcaacgacgccgag
ccgatcaacatgttcgagttcgcccggccggtgatcgaggcctgcggcgagaattggccc
cgggtccgggtgaacggtcccgtcgtgcgcgcggcgatgacgggttggcagcggctgcat
ttccggtttgggatacccgcgccgctgctcgagccgctggccgtcgagcggttgtatctg
gacaacttcttctcgatcgccaaggcgtctcgcgacctcggctatcagcccctgttcacc
acggagcaggcgctgtcggaatgtctgccctactacgtggggatgttcgaccagatgaag
cgagaagcgttggcgggcaaggcgtccgtctag

DBGET integrated database retrieval system